{
  "schemaVersion": 1,
  "peptide": {
    "slug": "retatrutide",
    "name": "Retatrutide",
    "canonicalUrl": "https://peptides.media/peptides/retatrutide"
  },
  "summary": "Retatrutide is Eli Lilly's investigational triple agonist: one peptide engineered to activate GIP, GLP-1, and glucagon receptors at the same time. Phase 2 trials in obesity and type 2 diabetes reported some of the largest weight-loss numbers published for a metabolic drug, and phase 3 programs are now reporting. None of it has produced an approved product anywhere. Vials sold online as RETA are not the verified study drug used in Lilly's trials.\n",
  "sections": [
    {
      "id": "quick-answer",
      "title": "Quick Answer",
      "items": [
        {
          "heading": "Retatrutide overview",
          "body": "Retatrutide is Eli Lilly's investigational triple agonist: one peptide engineered to activate GIP, GLP-1, and glucagon receptors at the same time. Phase 2 trials in obesity and type 2 diabetes reported some of the largest weight-loss numbers published for a metabolic drug, and phase 3 programs are now reporting. None of it has produced an approved product anywhere. Vials sold online as RETA are not the verified study drug used in Lilly's trials.\n\nRetatrutide in Lilly's trials is a controlled study drug, not a retatrutide-labeled research vial from the internet. Trial results tell us what happened with the studied molecule in monitored settings. A retail RETA vial still needs identity, sterility, stability, storage, handling, and quality documentation.\n\nThe retatrutide trial results are real and large, and they belong to Lilly's controlled study drug. No approved retatrutide exists, so products sold as RETA outside trials raise identity and quality questions the trial data cannot answer.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What is it?",
          "body": "Retatrutide, also LY3437943, is a once-weekly investigational peptide that activates GIP, GLP-1, and glucagon receptors. The glucagon component is what separates it from tirzepatide on paper.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Why do people talk about it?",
          "body": "The size of the numbers: peer-reviewed phase 2 trials in obesity and type 2 diabetes, plus sponsor phase 3 updates reporting large average weight loss. That reputation then gets attached to gray-market vials that were never part of any trial.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What do studies actually use?",
          "body": "Subcutaneous retatrutide in dose-ranging arms, with public sources describing 4 mg, 9 mg, and 12 mg arms over 40 to 80 week windows depending on the trial. A trial arm is a description of a monitored experiment, not a schedule to copy.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What does the online market get wrong?",
          "body": "It sells trial results as if they transfer to the vial in the listing. A vendor label, a COA, or a forum log still has to establish identity, assay, sterility, endotoxin control, storage, and chain of custody before trial data mean anything for that product.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What is still unsettled?",
          "body": "The final label, rare side effects, long-term safety in broad use, body-composition effects like fat mass versus lean mass, and who the drug suits. Alongside those, the standing gray-market problem: no non-trial product has verified identity, sterility, stability, storage, or handling.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What is the bottom line?",
          "body": "Keep three things separate: Lilly's trial retatrutide, the online RETA market, and whatever product may eventually be approved. The evidence lives with the first, the risk lives with the second, and the third does not exist yet.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "evidence-snapshot",
      "title": "Evidence Snapshot",
      "items": [
        {
          "heading": "Best-supported use",
          "body": "Weight and diabetes trial results\nPeer-reviewed phase 2 data exist for obesity and type 2 diabetes, and a 2026 phase 3 type 2 diabetes publication adds controlled late-stage evidence.",
          "evidenceType": "strong",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023",
            "retatrutide_lancet_t2d_phase2_2023",
            "retatrutide_lancet_transcend_t2d1_phase3_2026"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/",
            "https://pubmed.ncbi.nlm.nih.gov/37385280/",
            "https://pubmed.ncbi.nlm.nih.gov/42250575/"
          ]
        },
        {
          "heading": "Obesity phase 3 status",
          "body": "Important, but still not final labeling\nTRIUMPH-1 is registered, and sponsor topline/update material is public. That matters for the obesity story, but it is not a final FDA label or a completed regulator-reviewed prescribing package.",
          "evidenceType": "moderate",
          "sourceIds": [
            "retatrutide_ctgov_triumph1_nct05929066",
            "retatrutide_lilly_triumph1_topline_2026",
            "retatrutide_lilly_ada_update_2026"
          ],
          "sourceUrls": [
            "https://clinicaltrials.gov/study/NCT05929066",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-drove-substantial-improvements"
          ]
        },
        {
          "heading": "Long-term safety data",
          "body": "Still developing\nGastrointestinal events are the clearest tolerability theme in public reporting. Longer-term safety, rare events, discontinuation patterns, and final contraindication language remain less settled.",
          "evidenceType": "caution",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023",
            "retatrutide_lancet_t2d_phase2_2023",
            "retatrutide_lancet_transcend_t2d1_phase3_2026"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/",
            "https://pubmed.ncbi.nlm.nih.gov/37385280/",
            "https://pubmed.ncbi.nlm.nih.gov/42250575/"
          ]
        },
        {
          "heading": "Regulatory status",
          "body": "Investigational / not FDA-approved\nThe FDA UNII entry identifies the substance. It is not a drug approval or prescribing label.",
          "evidenceType": "caution",
          "sourceIds": [
            "retatrutide_fda_unii_nop2y096gv",
            "fda_glp1_solution_retatrutide_warning_2025",
            "fda_gram_peptides_retatrutide_warning_2026"
          ],
          "sourceUrls": [
            "https://precision.fda.gov/uniisearch/srs/unii/nop2y096gv",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
          ]
        },
        {
          "heading": "Product-quality risk",
          "body": "High outside trials\nFDA warning letters have named online retatrutide products as unapproved new-drug concerns. Product identity, batch quality, and contamination risk need separate checking before the trial data mean anything for a specific vial.",
          "evidenceType": "risk",
          "sourceIds": [
            "fda_xcel_research_retatrutide_warning_2024",
            "fda_prime_peptides_retatrutide_warning_2024",
            "fda_glp1_solution_retatrutide_warning_2025",
            "fda_gram_peptides_retatrutide_warning_2026"
          ],
          "sourceUrls": [
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/xcel-research-llc-694608-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/prime-vitality-inc-dba-prime-peptides-695156-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
          ]
        }
      ]
    },
    {
      "id": "claims-vs-evidence",
      "title": "Claims Vs Evidence",
      "items": [
        {
          "heading": "Retatrutide causes major weight loss.",
          "body": "Human evidence: Supported in clinical development. The human data include a peer-reviewed phase 2 obesity trial and phase 3 obesity sponsor reporting.\n\nMechanistic evidence: Triple receptor activity gives a plausible metabolic rationale, but the trial outcomes matter more than receptor theory.\n\nAnecdotal evidence: Online discussion repeats the weight-loss theme. Trials show the efficacy, dose context, monitoring, and longer-term risk. A non-trial vial also needs its own quality proof before the trial results mean much for that product.\n\nVerdict: Supported for studied clinical-trial populations. Online products sold as RETA need evidence of the vial contents and how the product was handled.",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023",
            "retatrutide_ctgov_triumph1_nct05929066",
            "retatrutide_lilly_triumph1_topline_2026"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/",
            "https://clinicaltrials.gov/study/NCT05929066",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss"
          ]
        },
        {
          "heading": "Retatrutide is better than tirzepatide or semaglutide.",
          "body": "Human evidence: No completed head-to-head outcomes trial is available. Public comparisons mostly rely on separate trials with different designs, populations, and durations.\n\nMechanistic evidence: Adding glucagon receptor activity is scientifically important, but superiority still has to come from comparative outcomes, not receptor count.\n\nAnecdotal evidence: This comparison is common online because the reported weight-loss numbers are large.\n\nVerdict: Superiority is not established. Current comparisons are indirect until head-to-head evidence or regulator-reviewed comparative data exist.",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023",
            "retatrutide_lilly_triumph1_topline_2026"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss"
          ]
        },
        {
          "heading": "Retatrutide improves blood sugar.",
          "body": "Human evidence: Supported in type 2 diabetes trials, including a peer-reviewed phase 2 trial and a 2026 phase 3 publication.\n\nMechanistic evidence: GIP and GLP-1 receptor activity fit the incretin rationale for glucose-dependent metabolic effects.\n\nAnecdotal evidence: Online reports exist, but controlled diabetes trials carry this claim better than anecdotes.\n\nVerdict: Supported in studied type 2 diabetes populations; final regulatory labeling is not available yet.",
          "sourceIds": [
            "retatrutide_lancet_t2d_phase2_2023",
            "retatrutide_lancet_transcend_t2d1_phase3_2026",
            "retatrutide_ctgov_transcend_t2d1_nct06354660"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37385280/",
            "https://pubmed.ncbi.nlm.nih.gov/42250575/",
            "https://clinicaltrials.gov/study/NCT06354660"
          ]
        },
        {
          "heading": "Gray-market RETA is the same as trial retatrutide.",
          "body": "Human evidence: Clinical-trial sources cover Lilly's study material, not online products sold as RETA.\n\nMechanistic evidence: This is about identity, quality, sterility, and chain of custody, not receptor theory.\n\nAnecdotal evidence: Vendor COAs, purity claims, and social buzz leave equivalence to controlled clinical-development material unresolved.\n\nVerdict: No. Trial data describe Lilly's study drug; a retail vial needs separate proof of identity, handling, and quality.",
          "sourceIds": [
            "fda_xcel_research_retatrutide_warning_2024",
            "fda_prime_peptides_retatrutide_warning_2024",
            "fda_glp1_solution_retatrutide_warning_2025",
            "fda_gram_peptides_retatrutide_warning_2026"
          ],
          "sourceUrls": [
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/xcel-research-llc-694608-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/prime-vitality-inc-dba-prime-peptides-695156-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
          ]
        },
        {
          "heading": "Retatrutide is already an approved medicine.",
          "body": "Human evidence: Public regulatory material treats retatrutide as investigational. The FDA UNII entry identifies the substance, but it is not an approval document.\n\nMechanistic evidence: Triple-receptor activity explains the metabolic interest, but approval still depends on a completed regulatory review.\n\nAnecdotal evidence: Some online discussion speaks as if availability equals approval, which is not how drug authorization works.\n\nVerdict: An approval claim needs a current FDA label, EMA EPAR, or comparable authorization document.",
          "sourceIds": [
            "retatrutide_fda_unii_nop2y096gv",
            "fda_glp1_solution_retatrutide_warning_2025",
            "fda_gram_peptides_retatrutide_warning_2026"
          ],
          "sourceUrls": [
            "https://precision.fda.gov/uniisearch/srs/unii/nop2y096gv",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
          ]
        }
      ]
    },
    {
      "id": "reader-bottom-line",
      "title": "Reader Bottom Line",
      "items": [
        {
          "heading": "If you just heard the name",
          "body": "Retatrutide is a legitimate drug candidate in Lilly's pipeline, and RETA sold online is not that drug. The big numbers come from monitored trials, not from anything currently for sale.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "If you are comparing metabolic peptides",
          "body": "The controlled human data are stronger than almost any online peptide claim, and they still leave regulatory status, long-term safety, product authenticity, and batch quality open. Headline weight-loss figures do not vouch for a vial.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Primary evidence hierarchy",
          "body": "Start with the peer-reviewed phase 2 trials and the 2026 phase 3 diabetes publication. Registry entries, sponsor updates, FDA warning letters, and chemistry records answer the development, regulatory, and identity questions around them.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "what-it-is",
      "title": "What It Is",
      "items": [
        {
          "heading": "What Retatrutide is",
          "body": "Retatrutide is LY3437943, a 39-amino-acid modified peptide engineered as a triple agonist at GIP, GLP-1, and glucagon receptors. The glucagon arm is meant to add energy-expenditure and substrate-mobilization biology on top of the incretin effects that made GLP-1 and dual agonists famous.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What Retatrutide is",
          "body": "On paper that puts it a step beyond both GLP-1-only drugs and dual agonists. Whether the step is a clinical advantage is a question for head-to-head trials, and no completed one exists.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "What Retatrutide is",
          "body": "Public discussion runs on two tracks that never meet: a controlled Lilly program with peer-reviewed results, and an off-trial RETA market that borrows the program's vocabulary while leaving identity, handling, and quality unanswered.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide in real-world discussion",
          "body": "Most retatrutide talk is comparison talk: whether it will beat tirzepatide or semaglutide, and whether the weight-loss signal is as large as it looks. Those comparisons stay indirect until head-to-head data exist.",
          "evidenceType": "real-world-reported",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide in real-world discussion",
          "body": "The second theme is access: research-use RETA listings, community titration logs, COA screenshots. None of that answers the batch questions, identity, sterility, stability, storage, and handling, that decide what is actually being injected.",
          "evidenceType": "real-world-reported",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "use-patterns",
      "title": "Use Patterns",
      "items": [
        {
          "heading": "Use patterns",
          "body": "Retatrutide use descriptions get confusing because trial schedules, registry entries, vendor pages, and forum posts are talking about different things. Trials and registries describe once-weekly subcutaneous study arms. Gray-market discussion often borrows that language while leaving the practical parts unclear: what is in the vial, how the batch was handled, who is monitoring the person, and how any titration is being decided.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Phase 2 obesity and overweight trial",
          "body": "Purpose: Weight-loss signal in adults with obesity or overweight without diabetes\nContext: Randomized phase 2 clinical trial\nRoute: Subcutaneous\nAmount: Dose-ranging study including arms up to 12 mg\nFrequency: Once weekly in the trial context\nDuration: 48 weeks\nThis peer-reviewed obesity trial shows the controlled regimen, follow-up, and adverse-event monitoring.",
          "evidenceType": "study-reported",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/"
          ]
        },
        {
          "heading": "Phase 2 type 2 diabetes trial",
          "body": "Purpose: Glycemic and weight-effect evidence in type 2 diabetes\nContext: Randomized, double-blind, placebo and active-controlled phase 2 trial\nRoute: Subcutaneous\nAmount: Dose-ranging study with arm-level titration in the full trial report\nFrequency: Once weekly in the trial context\nDuration: Arm-specific titration and timing are reported in the trial table\nThe diabetes population and comparator design matter as much as the dose. The arm-level titration is in the full report; pulling it into a simple schedule would make it look easier to copy than it is.",
          "evidenceType": "study-reported",
          "sourceIds": [
            "retatrutide_lancet_t2d_phase2_2023"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37385280/"
          ]
        },
        {
          "heading": "TRIUMPH-1 phase 3 obesity program",
          "body": "Purpose: Phase 3 obesity and overweight evidence\nContext: ClinicalTrials.gov registry plus sponsor topline and update sources\nRoute: Subcutaneous\nAmount: Public sponsor reporting describes 4 mg, 9 mg, and 12 mg arms\nFrequency: Once weekly in the phase 3 trial context\nDuration: 80 weeks in public sponsor reporting\nThe obesity phase 3 update is important, but final peer-reviewed publication and regulator-reviewed labeling are still needed.",
          "evidenceType": "study-reported",
          "sourceIds": [
            "retatrutide_ctgov_triumph1_nct05929066",
            "retatrutide_lilly_triumph1_topline_2026",
            "retatrutide_lilly_ada_update_2026"
          ],
          "sourceUrls": [
            "https://clinicaltrials.gov/study/NCT05929066",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-drove-substantial-improvements"
          ]
        },
        {
          "heading": "TRANSCEND-T2D-1 phase 3 diabetes program",
          "body": "Purpose: A1C and body-weight effects in type 2 diabetes\nContext: ClinicalTrials.gov registry plus 2026 peer-reviewed phase 3 publication\nRoute: Subcutaneous\nAmount: Public sources describe 4 mg, 9 mg, and 12 mg arms\nFrequency: Once weekly in the phase 3 trial context\nDuration: 40 weeks\nThis adds late-stage human diabetes data, but it is still not an FDA prescribing label. It also leaves the identity, sterility, and handling of compounded or gray-market exposure unanswered.",
          "evidenceType": "study-reported",
          "sourceIds": [
            "retatrutide_lancet_transcend_t2d1_phase3_2026",
            "retatrutide_ctgov_transcend_t2d1_nct06354660",
            "retatrutide_lilly_transcend_t2d1_topline_2026"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/42250575/",
            "https://clinicaltrials.gov/study/NCT06354660",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-demonstrated-significant"
          ]
        },
        {
          "heading": "Gray-market and forum triple-agonist use",
          "body": "Purpose: Weight loss and metabolic discussion\nContext: Vendor listings, forum logs, and community titration reports\nRoute: Subcutaneous injection\nAmount: Community reports commonly describe 1 to 4 mg weekly, often starting near 0.5 to 1 mg and titrating upward every 2 to 4 weeks. Some community logs describe 8 to 12 mg weekly, loosely mirroring the higher trial arms.\n\nFrequency: Once weekly, occasionally split into two administrations per week in community reports\nDuration: Multi-month titration runs, commonly 12 to 24 weeks in community logs\nRetatrutide has no approved product anywhere, so every real-world vial is unverified material. FDA has sent warning letters to online retatrutide sellers. Community practice loosely imitates phase 2 titration schedules without the trial monitoring. Shared here as context, not instruction.",
          "evidenceType": "real-world-reported",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Trial-schedule spillover discussion",
          "body": "Purpose: Comparing community schedules to the phase 2 design\nContext: Forums and protocol blogs\nRoute: Subcutaneous injection\nAmount: Trial arms used weekly doses titrated to 1, 4, 8, or 12 mg, and community discussion references these arms directly\nFrequency: Once weekly in the referenced trial design\nDuration: The cited trial ran 48 weeks; community runs are usually shorter\nReferencing a trial arm is not the same as reproducing it. The trial used verified drug, defined titration steps, and safety monitoring that gray-market use lacks.",
          "evidenceType": "real-world-reported",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Variables that change interpretation",
          "body": "Sources matter: peer-reviewed trials describe efficacy, sponsor updates flag program status, registry entries define study arms, FDA warning letters show enforcement risk, and forum posts show demand or confusion.\nRoute: trials describe subcutaneous retatrutide under controlled development; online route claims say little about product quality.\nAmount: public study arms such as 4 mg, 9 mg, and 12 mg are trial details tied to named sources.\nDuration: 40-, 48-, and 80-week windows belong to specific trials and updates, not to a universal retatrutide cycle.\nWhat is in the vial: identity, assay, impurities, sterility, endotoxin, batch traceability, storage, and chain of custody matter before any product claim is taken seriously.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "human-data",
      "title": "Human Data",
      "items": [
        {
          "heading": "Retatrutide human evidence summary",
          "body": "Retatrutide has more human data than nearly any unapproved peptide in circulation: peer-reviewed phase 2 trials in obesity and type 2 diabetes, a peer-reviewed phase 3 diabetes publication, and an obesity phase 3 program backed by registry and sponsor topline reporting. The obesity phase 3 story still needs final publication and regulatory review. The record contains no head-to-head trial against semaglutide or tirzepatide, and nothing in it validates a non-trial product. FDA warning letters document the enforcement side of that gap.",
          "evidenceType": "human-evidence",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Obesity and overweight phase 2",
          "body": "Population: Adults with obesity or overweight, without diabetes\nDesign: Randomized phase 2 clinical trial\nProduct context: Controlled clinical-development material\nMain outcome: The phase 2 obesity trial gives substantial human weight-loss data in the\nstudied population.\n\nLimitations: Mid-stage data, not an approval label, not a head-to-head comparison, and not validation of online products.\n\nEvidence weight: Strong signal, investigational context",
          "evidenceType": "human-evidence",
          "sourceIds": [
            "retatrutide_nejm_obesity_phase2_2023"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37366315/"
          ]
        },
        {
          "heading": "Type 2 diabetes phase 2",
          "body": "Population: Adults with type 2 diabetes\nDesign: Randomized, double-blind, placebo and active-controlled phase 2 trial\nProduct context: Controlled clinical-development material\nMain outcome: The phase 2 diabetes trial gives human glycemic and weight-effect evidence in a\ndiabetes population.\n\nLimitations: Phase 2 data do not give final label-level safety and use details.\n\nEvidence weight: Moderate human evidence",
          "evidenceType": "human-evidence",
          "sourceIds": [
            "retatrutide_lancet_t2d_phase2_2023"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/37385280/"
          ]
        },
        {
          "heading": "TRANSCEND-T2D-1",
          "body": "Population: Adults with type 2 diabetes and inadequate glycemic control with diet and exercise\nDesign: Randomized, double-blind phase 3 trial with ClinicalTrials.gov registration\nProduct context: Controlled clinical-development material\nMain outcome: TRANSCEND-T2D-1 gives phase 3 human evidence for A1C and body-weight effects in\ntype 2 diabetes.\n\nLimitations: It is still not an FDA approval label, and it does not bring compounded, gray-market, or unsupervised retatrutide exposure into the trial-drug evidence.\n\nEvidence weight: Phase 3 human evidence",
          "evidenceType": "human-evidence",
          "sourceIds": [
            "retatrutide_lancet_transcend_t2d1_phase3_2026",
            "retatrutide_ctgov_transcend_t2d1_nct06354660"
          ],
          "sourceUrls": [
            "https://pubmed.ncbi.nlm.nih.gov/42250575/",
            "https://clinicaltrials.gov/study/NCT06354660"
          ]
        },
        {
          "heading": "TRIUMPH-1",
          "body": "Population: Adults with obesity or overweight and at least one weight-related comorbidity, without diabetes\nDesign: Phase 3 registry plus sponsor topline/update sources\nProduct context: Controlled clinical-development program\nMain outcome: Sponsor reporting describes large mean body-weight reductions and cardiometabolic marker changes.\n\nLimitations: Sponsor topline material still needs final peer-reviewed publication and regulator-reviewed labeling.\n\nEvidence weight: Important but not final",
          "evidenceType": "human-evidence",
          "sourceIds": [
            "retatrutide_ctgov_triumph1_nct05929066",
            "retatrutide_lilly_triumph1_topline_2026",
            "retatrutide_lilly_ada_update_2026"
          ],
          "sourceUrls": [
            "https://clinicaltrials.gov/study/NCT05929066",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss",
            "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-drove-substantial-improvements"
          ]
        },
        {
          "heading": "Online RETA product claims",
          "body": "Population: Consumers exposed to online or research-use retatrutide marketing\nDesign: Regulatory enforcement sources\nProduct context: Gray-market product claims, not controlled clinical material\nMain outcome: FDA warning letters document authenticity and product-quality problems around online retatrutide claims.\n\nLimitations: Warning letters document named enforcement concerns; they do not characterize every vendor or every batch.\n\nEvidence weight: Quality-risk evidence, not an efficacy claim",
          "evidenceType": "human-evidence",
          "sourceIds": [
            "fda_xcel_research_retatrutide_warning_2024",
            "fda_prime_peptides_retatrutide_warning_2024",
            "fda_glp1_solution_retatrutide_warning_2025",
            "fda_gram_peptides_retatrutide_warning_2026"
          ],
          "sourceUrls": [
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/xcel-research-llc-694608-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/prime-vitality-inc-dba-prime-peptides-695156-12102024",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025",
            "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
          ]
        }
      ]
    },
    {
      "id": "safety",
      "title": "Safety",
      "items": [
        {
          "heading": "Retatrutide safety and unknowns",
          "body": "Gastrointestinal adverse events are the main tolerability theme across public trial reporting, including nausea, diarrhea, constipation, and vomiting.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide safety and unknowns",
          "body": "Long-term broad-use safety, rare-event rates, approval-grade contraindications, body-composition outcomes, and discontinuation patterns remain less mature than the efficacy headlines.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide safety and unknowns",
          "body": "Off-trial exposure adds a different risk layer: the product may not be clinical-trial material and may lack clinical monitoring, verified storage, verified sterility, or a regulator-reviewed product label.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "product-quality",
      "title": "Product Quality",
      "items": [
        {
          "heading": "Retatrutide product quality",
          "body": "Gray-market retatrutide matters because RETA is already sold online. Those listings are different from the clinical-trial drug.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide product quality",
          "body": "FDA warning letters have named online retatrutide products as unapproved new-drug concerns. That does not mean every product is fake, but vendor claims and a PDF COA still have to prove identity, sterility, storage, and chain of custody.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Identity",
          "body": "The product has to be shown to be retatrutide, not merely labeled RETA.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Assay and impurities",
          "body": "Percent purity alone can miss the impurity profile and method quality that matter for modified peptides.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Sterility and endotoxin",
          "body": "A peptide identity claim says nothing about contamination risk.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Batch traceability",
          "body": "A COA is weak if it cannot be tied to the exact material, lot, storage, and chain of custody.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Storage and stability",
          "body": "A lab result from one point in time captures only the tested moment; shipping, storage, reconstitution, and handling can still change the material.",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Regulatory context",
          "body": "A \"research use\" label is labeling context. It says nothing about lawful status, product quality, clinical monitoring, or patient fit.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "mechanism",
      "title": "Mechanism",
      "items": [
        {
          "heading": "Retatrutide mechanism",
          "body": "Retatrutide is designed to push three metabolic signaling systems at once: appetite and glucose signaling through GLP-1, incretin/metabolic signaling through GIP, and energy-substrate signaling through glucagon.",
          "evidenceType": "mechanism",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide mechanism detail",
          "body": "The GLP-1 component is the most familiar part. It fits the broader incretin-drug pattern of appetite and glucose-dependent insulin effects.",
          "evidenceType": "mechanism",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide mechanism detail",
          "body": "The GIP component is intended to add another incretin pathway rather than simply duplicate GLP-1 activity.",
          "evidenceType": "mechanism",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide mechanism detail",
          "body": "The glucagon receptor component is the less familiar part. It is meant to add energy-expenditure and substrate-mobilization biology, but the practical value has to be judged from trials, not receptor theory alone.",
          "evidenceType": "mechanism",
          "sourceIds": [],
          "sourceUrls": []
        },
        {
          "heading": "Retatrutide mechanism detail",
          "body": "The same glucagon component is the proposed source of the larger phase 2 weight-loss numbers, the hepatic-fat effects, and the heart-rate signal seen in trials.",
          "evidenceType": "mechanism",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    },
    {
      "id": "technical-dossier",
      "title": "Technical Dossier",
      "items": [
        {
          "heading": "Retatrutide technical dossier",
          "body": "Designation: Retatrutide / LY3437943 / LY-3437943\nClass: Investigational GIP, GLP-1, and glucagon receptor agonist\nBackbone sequence: YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS\nMolecular formula: C221H342N46O68\nMolar mass: 4731 g/mol\nStructure details: Modified peptide with lipidation and terminal chemistry\nRoute in trials: Subcutaneous\nRegulatory status: Investigational; FDA warnings name online retatrutide as unapproved\nProduct-quality split: Trial drug and online RETA need separate quality checks\nHalf-life: About 6 days in phase 1 and 2 data, supporting the once-weekly trial schedules.",
          "sourceIds": [],
          "sourceUrls": []
        }
      ]
    }
  ],
  "sources": [
    {
      "id": "retatrutide_nejm_obesity_phase2_2023",
      "label": "PubMed",
      "reference": "Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial",
      "url": "https://pubmed.ncbi.nlm.nih.gov/37366315/"
    },
    {
      "id": "retatrutide_lancet_t2d_phase2_2023",
      "label": "PubMed",
      "reference": "Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes",
      "url": "https://pubmed.ncbi.nlm.nih.gov/37385280/"
    },
    {
      "id": "retatrutide_lancet_transcend_t2d1_phase3_2026",
      "label": "PubMed",
      "reference": "Efficacy and safety of retatrutide, a GIP, GLP-1, and glucagon receptor agonist, in people with type 2 diabetes and inadequate glycaemic control with diet and exercise (TRANSCEND-T2D-1)",
      "url": "https://pubmed.ncbi.nlm.nih.gov/42250575/"
    },
    {
      "id": "retatrutide_ctgov_triumph1_nct05929066",
      "label": "ClinicalTrials.gov",
      "reference": "TRIUMPH-1 ClinicalTrials.gov record",
      "url": "https://clinicaltrials.gov/study/NCT05929066"
    },
    {
      "id": "retatrutide_ctgov_transcend_t2d1_nct06354660",
      "label": "ClinicalTrials.gov",
      "reference": "TRANSCEND-T2D-1 ClinicalTrials.gov record",
      "url": "https://clinicaltrials.gov/study/NCT06354660"
    },
    {
      "id": "retatrutide_lilly_triumph1_topline_2026",
      "label": "Other",
      "reference": "Lilly's triple agonist, retatrutide, delivered powerful weight loss in pivotal Phase 3 obesity trial",
      "url": "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-delivered-powerful-weight-loss"
    },
    {
      "id": "retatrutide_lilly_transcend_t2d1_topline_2026",
      "label": "Other",
      "reference": "Lilly's triple agonist, retatrutide, demonstrated significant reductions in A1C and weight in first Phase 3 trial for treatment of type 2 diabetes",
      "url": "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-demonstrated-significant"
    },
    {
      "id": "retatrutide_lilly_ada_update_2026",
      "label": "Other",
      "reference": "Lilly's triple agonist, retatrutide, drove substantial improvements in weight, A1C, knee osteoarthritis pain, and obstructive sleep apnea",
      "url": "https://investor.lilly.com/news-releases/news-release-details/lillys-triple-agonist-retatrutide-drove-substantial-improvements"
    },
    {
      "id": "fda_xcel_research_retatrutide_warning_2024",
      "label": "FDA",
      "reference": "Xcel Research LLC warning letter",
      "url": "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/xcel-research-llc-694608-12102024"
    },
    {
      "id": "fda_prime_peptides_retatrutide_warning_2024",
      "label": "FDA",
      "reference": "Prime Vitality, Inc. dba Prime Peptides warning letter",
      "url": "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/prime-vitality-inc-dba-prime-peptides-695156-12102024"
    },
    {
      "id": "fda_glp1_solution_retatrutide_warning_2025",
      "label": "FDA",
      "reference": "GLP-1 Solution warning letter",
      "url": "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/glp-1-solution-715883-09092025"
    },
    {
      "id": "fda_gram_peptides_retatrutide_warning_2026",
      "label": "FDA",
      "reference": "Gram Peptides warning letter",
      "url": "https://www.fda.gov/inspections-compliance-enforcement-and-criminal-investigations/warning-letters/gram-peptides-721806-03312026"
    },
    {
      "id": "retatrutide_pubchem_cid_171390338",
      "label": "PubChem",
      "reference": "PubChem Compound Summary for Retatrutide",
      "url": "https://pubchem.ncbi.nlm.nih.gov/compound/171390338"
    },
    {
      "id": "retatrutide_fda_unii_nop2y096gv",
      "label": "FDA",
      "reference": "UNII Search Service record for Retatrutide",
      "url": "https://precision.fda.gov/uniisearch/srs/unii/nop2y096gv"
    }
  ],
  "useNote": "This packet preserves the evidence labels and source trail from the Peptides.media article. Reported use patterns describe published studies or documented real-world discussion. They are not personalized recommendations."
}