Peptide education

Retatrutide

RETA · LY3437943 · LY-3437943 · Triple agonist

Retatrutide is Eli Lilly's investigational triple agonist: one peptide engineered to activate GIP, GLP-1, and glucagon receptors at the same time. Phase 2 trials in obesity and type 2 diabetes reported some of the largest weight-loss numbers published for a metabolic drug, and phase 3 programs are now reporting. None of it has produced an approved product anywhere. Vials sold online as RETA are not the verified study drug used in Lilly's trials.

The retatrutide trial results are real and large, and they belong to Lilly's controlled study drug. No approved retatrutide exists, so products sold as RETA outside trials raise identity and quality questions the trial data cannot answer.

Primary useObesity and type 2 diabetes research
EvidencePhase 2 plus phase 3 human data
Regulatory statusInvestigational
Common routeSubcutaneous in trials
Product issueHigh gray-market risk

Overview

Quick answer

Retatrutide in Lilly's trials is a controlled study drug, not a retatrutide-labeled research vial from the internet. Trial results tell us what happened with the studied molecule in monitored settings. A retail RETA vial still needs identity, sterility, stability, storage, handling, and quality documentation.

What is it?

Retatrutide, also LY3437943, is a once-weekly investigational peptide that activates GIP, GLP-1, and glucagon receptors. The glucagon component is what separates it from tirzepatide on paper.

Why do people talk about it?

The size of the numbers: peer-reviewed phase 2 trials in obesity and type 2 diabetes, plus sponsor phase 3 updates reporting large average weight loss. That reputation then gets attached to gray-market vials that were never part of any trial.

What do studies actually use?

Subcutaneous retatrutide in dose-ranging arms, with public sources describing 4 mg, 9 mg, and 12 mg arms over 40 to 80 week windows depending on the trial. A trial arm is a description of a monitored experiment, not a schedule to copy.

What does the online market get wrong?

It sells trial results as if they transfer to the vial in the listing. A vendor label, a COA, or a forum log still has to establish identity, assay, sterility, endotoxin control, storage, and chain of custody before trial data mean anything for that product.

What is still unsettled?

The final label, rare side effects, long-term safety in broad use, body-composition effects like fat mass versus lean mass, and who the drug suits. Alongside those, the standing gray-market problem: no non-trial product has verified identity, sterility, stability, storage, or handling.

What is the bottom line?

Keep three things separate: Lilly's trial retatrutide, the online RETA market, and whatever product may eventually be approved. The evidence lives with the first, the risk lives with the second, and the third does not exist yet.

Reported practice

Commonly reported protocol

Retatrutide community-reported use
Route
Subcutaneous injection
Typical amount
Community reports commonly describe 1 to 4 mg weekly, often starting near 0.5 to 1 mg and titrating upward every 2 to 4 weeks. Some community logs describe 8 to 12 mg weekly, loosely mirroring the higher trial arms.
Frequency
Once weekly, occasionally split into two administrations per week in community reports
Duration
Multi-month titration runs, commonly 12 to 24 weeks in community logs

Gray-market and forum triple-agonist use. Community-reported patterns, not verified by controlled human trials and not a use recommendation. Full use-pattern detail

Evidence

Evidence snapshot

Best-supported useWeight and diabetes trial results

Peer-reviewed phase 2 data exist for obesity and type 2 diabetes, and a 2026 phase 3 type 2 diabetes publication adds controlled late-stage evidence.

Obesity phase 3 statusImportant, but still not final labeling

TRIUMPH-1 is registered, and sponsor topline/update material is public. That matters for the obesity story, but it is not a final FDA label or a completed regulator-reviewed prescribing package.

Long-term safety dataStill developing

Gastrointestinal events are the clearest tolerability theme in public reporting. Longer-term safety, rare events, discontinuation patterns, and final contraindication language remain less settled.

Regulatory statusInvestigational / not FDA-approved

The FDA UNII entry identifies the substance. It is not a drug approval or prescribing label.

Product-quality riskHigh outside trials

FDA warning letters have named online retatrutide products as unapproved new-drug concerns. Product identity, batch quality, and contamination risk need separate checking before the trial data mean anything for a specific vial.

Claims

Common claims vs evidence

ClaimHuman evidenceMechanistic evidenceAnecdotal evidenceVerdict
Retatrutide causes major weight loss.Supported in clinical development. The human data include a peer-reviewed phase 2 obesity trial and phase 3 obesity sponsor reporting. Triple receptor activity gives a plausible metabolic rationale, but the trial outcomes matter more than receptor theory. Online discussion repeats the weight-loss theme. Trials show the efficacy, dose context, monitoring, and longer-term risk. A non-trial vial also needs its own quality proof before the trial results mean much for that product. Supported for studied clinical-trial populations. Online products sold as RETA need evidence of the vial contents and how the product was handled.
Retatrutide is better than tirzepatide or semaglutide.No completed head-to-head outcomes trial is available. Public comparisons mostly rely on separate trials with different designs, populations, and durations. Adding glucagon receptor activity is scientifically important, but superiority still has to come from comparative outcomes, not receptor count. This comparison is common online because the reported weight-loss numbers are large. Superiority is not established. Current comparisons are indirect until head-to-head evidence or regulator-reviewed comparative data exist.
Retatrutide improves blood sugar.Supported in type 2 diabetes trials, including a peer-reviewed phase 2 trial and a 2026 phase 3 publication. GIP and GLP-1 receptor activity fit the incretin rationale for glucose-dependent metabolic effects. Online reports exist, but controlled diabetes trials carry this claim better than anecdotes. Supported in studied type 2 diabetes populations; final regulatory labeling is not available yet.
Gray-market RETA is the same as trial retatrutide.Clinical-trial sources cover Lilly's study material, not online products sold as RETA. This is about identity, quality, sterility, and chain of custody, not receptor theory. Vendor COAs, purity claims, and social buzz leave equivalence to controlled clinical-development material unresolved. No. Trial data describe Lilly's study drug; a retail vial needs separate proof of identity, handling, and quality.
Retatrutide is already an approved medicine.Public regulatory material treats retatrutide as investigational. The FDA UNII entry identifies the substance, but it is not an approval document. Triple-receptor activity explains the metabolic interest, but approval still depends on a completed regulatory review. Some online discussion speaks as if availability equals approval, which is not how drug authorization works. An approval claim needs a current FDA label, EMA EPAR, or comparable authorization document.

Bottom line

Main takeaway

If you just heard the name

Retatrutide is a legitimate drug candidate in Lilly's pipeline, and RETA sold online is not that drug. The big numbers come from monitored trials, not from anything currently for sale.

If you are comparing metabolic peptides

The controlled human data are stronger than almost any online peptide claim, and they still leave regulatory status, long-term safety, product authenticity, and batch quality open. Headline weight-loss figures do not vouch for a vial.

Primary evidence hierarchy

Start with the peer-reviewed phase 2 trials and the 2026 phase 3 diabetes publication. Registry entries, sponsor updates, FDA warning letters, and chemistry records answer the development, regulatory, and identity questions around them.

Identity

What it is

Retatrutide is LY3437943, a 39-amino-acid modified peptide engineered as a triple agonist at GIP, GLP-1, and glucagon receptors. The glucagon arm is meant to add energy-expenditure and substrate-mobilization biology on top of the incretin effects that made GLP-1 and dual agonists famous.

On paper that puts it a step beyond both GLP-1-only drugs and dual agonists. Whether the step is a clinical advantage is a question for head-to-head trials, and no completed one exists.

Public discussion runs on two tracks that never meet: a controlled Lilly program with peer-reviewed results, and an off-trial RETA market that borrows the program's vocabulary while leaving identity, handling, and quality unanswered.

How people talk about it online

Most retatrutide talk is comparison talk: whether it will beat tirzepatide or semaglutide, and whether the weight-loss signal is as large as it looks. Those comparisons stay indirect until head-to-head data exist.

The second theme is access: research-use RETA listings, community titration logs, COA screenshots. None of that answers the batch questions, identity, sterility, stability, storage, and handling, that decide what is actually being injected.

Use context

Routes, doses, and cycle patterns

Retatrutide use descriptions get confusing because trial schedules, registry entries, vendor pages, and forum posts are talking about different things. Trials and registries describe once-weekly subcutaneous study arms. Gray-market discussion often borrows that language while leaving the practical parts unclear: what is in the vial, how the batch was handled, who is monitoring the person, and how any titration is being decided.

Human studies and product labels

Phase 2 obesity and overweight trial

Purpose
Weight-loss signal in adults with obesity or overweight without diabetes
Context
Randomized phase 2 clinical trial
Route
Subcutaneous
Amount
Dose-ranging study including arms up to 12 mg
Frequency
Once weekly in the trial context
Duration
48 weeks

This peer-reviewed obesity trial shows the controlled regimen, follow-up, and adverse-event monitoring.

Phase 2 type 2 diabetes trial

Purpose
Glycemic and weight-effect evidence in type 2 diabetes
Context
Randomized, double-blind, placebo and active-controlled phase 2 trial
Route
Subcutaneous
Amount
Dose-ranging study with arm-level titration in the full trial report
Frequency
Once weekly in the trial context
Duration
Arm-specific titration and timing are reported in the trial table

The diabetes population and comparator design matter as much as the dose. The arm-level titration is in the full report; pulling it into a simple schedule would make it look easier to copy than it is.

TRIUMPH-1 phase 3 obesity program

Purpose
Phase 3 obesity and overweight evidence
Context
ClinicalTrials.gov registry plus sponsor topline and update sources
Route
Subcutaneous
Amount
Public sponsor reporting describes 4 mg, 9 mg, and 12 mg arms
Frequency
Once weekly in the phase 3 trial context
Duration
80 weeks in public sponsor reporting

The obesity phase 3 update is important, but final peer-reviewed publication and regulator-reviewed labeling are still needed.

TRANSCEND-T2D-1 phase 3 diabetes program

Purpose
A1C and body-weight effects in type 2 diabetes
Context
ClinicalTrials.gov registry plus 2026 peer-reviewed phase 3 publication
Route
Subcutaneous
Amount
Public sources describe 4 mg, 9 mg, and 12 mg arms
Frequency
Once weekly in the phase 3 trial context
Duration
40 weeks

This adds late-stage human diabetes data, but it is still not an FDA prescribing label. It also leaves the identity, sterility, and handling of compounded or gray-market exposure unanswered.

Real-world discussion

Gray-market and forum triple-agonist use

Purpose
Weight loss and metabolic discussion
Context
Vendor listings, forum logs, and community titration reports
Route
Subcutaneous injection
Amount
Community reports commonly describe 1 to 4 mg weekly, often starting near 0.5 to 1 mg and titrating upward every 2 to 4 weeks. Some community logs describe 8 to 12 mg weekly, loosely mirroring the higher trial arms.
Frequency
Once weekly, occasionally split into two administrations per week in community reports
Duration
Multi-month titration runs, commonly 12 to 24 weeks in community logs

Retatrutide has no approved product anywhere, so every real-world vial is unverified material. FDA has sent warning letters to online retatrutide sellers. Community practice loosely imitates phase 2 titration schedules without the trial monitoring. Shared here as context, not instruction.

Trial-schedule spillover discussion

Purpose
Comparing community schedules to the phase 2 design
Context
Forums and protocol blogs
Route
Subcutaneous injection
Amount
Trial arms used weekly doses titrated to 1, 4, 8, or 12 mg, and community discussion references these arms directly
Frequency
Once weekly in the referenced trial design
Duration
The cited trial ran 48 weeks; community runs are usually shorter

Referencing a trial arm is not the same as reproducing it. The trial used verified drug, defined titration steps, and safety monitoring that gray-market use lacks.

What varies

  • Sources matter: peer-reviewed trials describe efficacy, sponsor updates flag program status, registry entries define study arms, FDA warning letters show enforcement risk, and forum posts show demand or confusion.
  • Route: trials describe subcutaneous retatrutide under controlled development; online route claims say little about product quality.
  • Amount: public study arms such as 4 mg, 9 mg, and 12 mg are trial details tied to named sources.
  • Duration: 40-, 48-, and 80-week windows belong to specific trials and updates, not to a universal retatrutide cycle.
  • What is in the vial: identity, assay, impurities, sterility, endotoxin, batch traceability, storage, and chain of custody matter before any product claim is taken seriously.

Human data

Human evidence

Retatrutide has more human data than nearly any unapproved peptide in circulation: peer-reviewed phase 2 trials in obesity and type 2 diabetes, a peer-reviewed phase 3 diabetes publication, and an obesity phase 3 program backed by registry and sponsor topline reporting. The obesity phase 3 story still needs final publication and regulatory review. The record contains no head-to-head trial against semaglutide or tirzepatide, and nothing in it validates a non-trial product. FDA warning letters document the enforcement side of that gap.

Development timeline

Retatrutide has moved from phase 2 data to phase 3 program data, but it still has no FDA label.

Phase 2 obesity

Peer-reviewed human obesity and overweight data.

Phase 2 type 2 diabetes

Peer-reviewed human diabetes data.

Phase 3 type 2 diabetes

Registry-linked peer-reviewed 2026 Lancet publication.

Phase 3 obesity

Registry plus sponsor topline/update sources; final publication and label review still matter.

Study / evidence areaPopulationDesignProduct contextMain outcomeLimitationsWeight
Obesity and overweight phase 2Adults with obesity or overweight, without diabetesRandomized phase 2 clinical trialControlled clinical-development materialThe phase 2 obesity trial gives substantial human weight-loss data in the studied population. Mid-stage data, not an approval label, not a head-to-head comparison, and not validation of online products. Strong signal, investigational context
Type 2 diabetes phase 2Adults with type 2 diabetesRandomized, double-blind, placebo and active-controlled phase 2 trialControlled clinical-development materialThe phase 2 diabetes trial gives human glycemic and weight-effect evidence in a diabetes population. Phase 2 data do not give final label-level safety and use details. Moderate human evidence
TRANSCEND-T2D-1Adults with type 2 diabetes and inadequate glycemic control with diet and exerciseRandomized, double-blind phase 3 trial with ClinicalTrials.gov registrationControlled clinical-development materialTRANSCEND-T2D-1 gives phase 3 human evidence for A1C and body-weight effects in type 2 diabetes. It is still not an FDA approval label, and it does not bring compounded, gray-market, or unsupervised retatrutide exposure into the trial-drug evidence. Phase 3 human evidence
TRIUMPH-1Adults with obesity or overweight and at least one weight-related comorbidity, without diabetesPhase 3 registry plus sponsor topline/update sourcesControlled clinical-development programSponsor reporting describes large mean body-weight reductions and cardiometabolic marker changes. Sponsor topline material still needs final peer-reviewed publication and regulator-reviewed labeling. Important but not final
Online RETA product claimsConsumers exposed to online or research-use retatrutide marketingRegulatory enforcement sourcesGray-market product claims, not controlled clinical materialFDA warning letters document authenticity and product-quality problems around online retatrutide claims. Warning letters document named enforcement concerns; they do not characterize every vendor or every batch. Quality-risk evidence, not an efficacy claim

Cautions

Safety and unknowns

  • Gastrointestinal adverse events are the main tolerability theme across public trial reporting, including nausea, diarrhea, constipation, and vomiting.
  • Long-term broad-use safety, rare-event rates, approval-grade contraindications, body-composition outcomes, and discontinuation patterns remain less mature than the efficacy headlines.
  • Off-trial exposure adds a different risk layer: the product may not be clinical-trial material and may lack clinical monitoring, verified storage, verified sterility, or a regulator-reviewed product label.

Product quality

A vial label is only a starting point

Gray-market retatrutide matters because RETA is already sold online. Those listings are different from the clinical-trial drug.

FDA warning letters have named online retatrutide products as unapproved new-drug concerns. That does not mean every product is fake, but vendor claims and a PDF COA still have to prove identity, sterility, storage, and chain of custody.

Identity

The product has to be shown to be retatrutide, not merely labeled RETA.

Assay and impurities

Percent purity alone can miss the impurity profile and method quality that matter for modified peptides.

Sterility and endotoxin

A peptide identity claim says nothing about contamination risk.

Batch traceability

A COA is weak if it cannot be tied to the exact material, lot, storage, and chain of custody.

Storage and stability

A lab result from one point in time captures only the tested moment; shipping, storage, reconstitution, and handling can still change the material.

Regulatory context

A "research use" label is labeling context. It says nothing about lawful status, product quality, clinical monitoring, or patient fit.

Mechanism

How it is proposed to work

Retatrutide is designed to push three metabolic signaling systems at once: appetite and glucose signaling through GLP-1, incretin/metabolic signaling through GIP, and energy-substrate signaling through glucagon.

01

The GLP-1 component is the most familiar part. It fits the broader incretin-drug pattern of appetite and glucose-dependent insulin effects.

02

The GIP component is intended to add another incretin pathway rather than simply duplicate GLP-1 activity.

03

The glucagon receptor component is the less familiar part. It is meant to add energy-expenditure and substrate-mobilization biology, but the practical value has to be judged from trials, not receptor theory alone.

04

The same glucagon component is the proposed source of the larger phase 2 weight-loss numbers, the hepatic-fat effects, and the heart-rate signal seen in trials.

Structure

Structure and sequence

A modified 39-residue peptide drug candidate. The sequence shown here is a standard-letter backbone approximation; the actual substance includes non-standard residues, lipidation, and terminal chemistry that do not fit a simple natural-amino-acid model.

Retatrutide structure details
Designation
Retatrutide / LY3437943
Backbone sequence
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
Structural label
modified peptide - 39 AA
Molecular formula
C221H342N46O68
Molar mass
4731 g/mol
Isoelectric point
not available

Sequence note

Backbone approximation: YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS. Public chemistry records identify non-standard residue and lipidation details that are not represented by one-letter amino-acid codes.

Why there is no atom model

Retatrutide includes modified chemistry, so a simple linear peptide model would be misleading.

01

FDA UNII lists Retatrutide / NOP2Y096GV and synonyms including LY3437943 and LY-3437943; UNII availability does not imply regulatory approval.

02

PubChem CID 171390338 maps the formula C221H342N46O68 and molecular weight context used here.

03

Use the BPC interactive viewer only for simple one-letter peptide chains. Retatrutide is rendered as a modified-molecule summary to avoid implying a solved or natural-residue-only structure.

Molecular formulaC221H342N46O68
Molar mass4731 g/mol
Structure modemodified peptide - 39 AA

FAQ

Common questions

Is retatrutide FDA-approved?

Available regulatory material still describes retatrutide as investigational. It is not an approved medicine without a current FDA label, EMA EPAR, or comparable authorization document. The FDA UNII record identifies the substance but does not imply approval.

Is gray-market RETA the same thing as the trial drug?

No. Trial evidence describes a controlled development program. Online products marketed as RETA or retatrutide need separate scrutiny for identity, assay, impurities, sterility, endotoxin, chain of custody, and storage. FDA warning letters have named online retatrutide products as unapproved new-drug concerns.

Is there a retatrutide protocol?

The concrete schedules are trial schedules. They explain how named studies were run; they are not prescribing directions or a real-world use standard.

Details

Technical details

Retatrutide technical details
Designation
Retatrutide / LY3437943 / LY-3437943
Class
Investigational GIP, GLP-1, and glucagon receptor agonist
Backbone sequence
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
Molecular formula
C221H342N46O68
Molar mass
4731 g/mol
Structure details
Modified peptide with lipidation and terminal chemistry
Route in trials
Subcutaneous
Regulatory status
Investigational; FDA warnings name online retatrutide as unapproved
Product-quality split
Trial drug and online RETA need separate quality checks
Half-life
About 6 days in phase 1 and 2 data, supporting the once-weekly trial schedules.

Sources

References

  1. 1.

    PubMed. Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial 2023.

    doi:10.1056/NEJMoa2301972 PMID:37366315 Accessed 2026-06-09.

    Primary peer-reviewed phase 2 trial in adults with obesity or overweight; supports the main human obesity evidence.

  2. 2.

    PubMed. Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes 2023.

    doi:10.1016/S0140-6736(23)01053-X PMID:37385280 Accessed 2026-06-09.

    Primary peer-reviewed phase 2 type 2 diabetes trial; supports the glycemic and weight-effect evidence.

  3. 3.

    PubMed. Efficacy and safety of retatrutide, a GIP, GLP-1, and glucagon receptor agonist, in people with type 2 diabetes and inadequate glycaemic control with diet and exercise (TRANSCEND-T2D-1) 2026.

    doi:10.1016/S0140-6736(26)00967-0 PMID:42250575 Accessed 2026-06-09.

    Peer-reviewed phase 3 TRANSCEND-T2D-1 publication linked from ClinicalTrials.gov; supports the current type 2 diabetes evidence.

  4. 4.

    ClinicalTrials.gov. TRIUMPH-1 ClinicalTrials.gov record 2026.

    NCT05929066 Accessed 2026-06-09.

    Registry record for the phase 3 obesity/overweight TRIUMPH-1 trial.

  5. 5.

    ClinicalTrials.gov. TRANSCEND-T2D-1 ClinicalTrials.gov record 2026.

    NCT06354660 Accessed 2026-06-09.

    Registry record for the phase 3 type 2 diabetes TRANSCEND-T2D-1 trial.

  6. 6.

    Other. Lilly's triple agonist, retatrutide, delivered powerful weight loss in pivotal Phase 3 obesity trial 2026.

    Accessed 2026-06-09.

    Sponsor topline release for TRIUMPH-1; useful as current sponsor context, not a substitute for peer-reviewed publication or regulatory label review.

  7. 7.

    Other. Lilly's triple agonist, retatrutide, demonstrated significant reductions in A1C and weight in first Phase 3 trial for treatment of type 2 diabetes 2026.

    Accessed 2026-06-09.

    Sponsor topline release for TRANSCEND-T2D-1; useful as current sponsor context, not a substitute for peer-reviewed publication or regulatory label review.

  8. 8.

    Other. Lilly's triple agonist, retatrutide, drove substantial improvements in weight, A1C, knee osteoarthritis pain, and obstructive sleep apnea 2026.

    Accessed 2026-06-09.

    Lilly update around ADA 2026 with adverse-event, TRANSCEND-T2D-1, and TRIUMPH-1 context; sponsor source, not final labeling.

  9. 9.

    FDA. Xcel Research LLC warning letter 2024.

    Accessed 2026-06-09.

    FDA warning letter naming RETA/retatrutide products offered online and describing unapproved new-drug concerns.

  10. 10.

    FDA. Prime Vitality, Inc. dba Prime Peptides warning letter 2024.

    Accessed 2026-06-09.

    FDA warning letter naming retatrutide products and explaining that research-purpose disclaimers did not overcome evidence of intended human drug use.

  11. 11.

    FDA. GLP-1 Solution warning letter 2025.

    Accessed 2026-06-09.

    FDA warning letter stating that compounded retatrutide products were unapproved new drugs and that retatrutide is not a component of an FDA-approved human drug.

  12. 12.

    FDA. Gram Peptides warning letter 2026.

    Accessed 2026-06-09.

    FDA warning letter naming retatrutide products offered online and describing them as unapproved new drugs with no approved applications in effect for the products.

  13. 13.

    PubChem. PubChem Compound Summary for Retatrutide 2026.

    Accessed 2026-06-09.

    Chemistry source for Retatrutide CID 171390338, molecular formula, and molecular-weight context.

  14. 14.

    FDA. UNII Search Service record for Retatrutide 2026.

    Accessed 2026-06-09.

    FDA Substance Registration System record for Retatrutide / UNII NOP2Y096GV; UNII availability does not imply regulatory review or approval.