Peptide education
Sermorelin
Geref · GHRH 1-29 · GRF 1-29 · GHRH(1-29)NH2
Sermorelin is a 29-amino-acid fragment of human growth hormone-releasing hormone, once sold as the regulated drug Geref. It pushes the pituitary to release its own growth hormone rather than supplying GH, and its real track record is old and specific: pediatric growth-hormone-deficiency treatment and diagnostic stimulation testing. Geref left the market in 2008, and FDA later confirmed the withdrawal was not for safety or effectiveness reasons. What the anti-aging market sells today is that history pointed at new goals: sleep, fat loss, vitality, and recovery claims the sermorelin-specific human evidence never tested.
Sermorelin's solid evidence belongs to a pediatric drug that no longer exists as a product. The modern wellness version inherits the name, not the trial record: for adult sleep, fat loss, and anti-aging, the human data amount to one exploratory study.
Overview
Quick answer
Sermorelin is not tesamorelin, somatropin, macimorelin, or a Sermorelin + Ipamorelin blend. The historical Geref products were regulated drug products used in pediatric growth-hormone deficiency and GH stimulation testing. Many current products are compounded, clinic-supplied, or research-use vials, where identity, sterility, potency, storage, and oversight need product-specific documentation.
What is Sermorelin?
Sermorelin is the amidated first 29 amino acids of human GHRH, the shortest fragment with full activity at the GHRH receptor. It signals the pituitary to release growth hormone, so it only works in an axis that can still respond.
What was it used for historically?
FDA records describe Geref products for two jobs: treating growth failure in children with growth hormone deficiency, and testing whether the pituitary can release GH on demand. Those products left the market in 2008 for business reasons, not because FDA found them unsafe or ineffective.
What do people use it for or talk about now?
Anti-aging, sleep, energy, focus, weight management, body composition: the modern pitch is a wellness list, not an endocrine one. That conversation runs on clinic marketing and personal reports, a different evidence class than the pediatric and diagnostic studies.
What dose and schedule details are documented?
The documented numbers come from settings that no longer map to today's market: 30 mcg/kg/day at bedtime for up to a year in the pediatric study, IV 1 mcg/kg for diagnostic challenge, and 1 mg nightly for six months in the older-adult cognition trial. Clinic and forum schedules copy the bedtime-injection idea without the studied population or the studied product.
How strong are the wellness claims?
Weak at the sermorelin-specific level. The one healthy-older-adult trial raised GH and IGF-1 and reported modest cognitive-test changes: exploratory data, not a foundation for fat-loss, longevity, or vitality promises. Most current products are compounded or research-use vials rather than the studied drug, which widens the gap further.
Reported practice
Commonly reported protocol
Clinic GH-optimization programs. Community-reported patterns, not verified by controlled human trials and not a use recommendation. Full use-pattern detail
Evidence
Evidence snapshot
FDA records support the historical regulated-product history, including pediatric and diagnostic uses, but not an approval for today's broad wellness or anti-aging market.
A 1-year pediatric multicenter study reported mean height velocity rising from 4.1 cm/year at baseline to 8.0 cm/year at 6 months and 7.2 cm/year at 12 months with bedtime subcutaneous GHRH (1-29).
Adult evidence for sermorelin itself is limited. One older healthy-aging study reported GH, IGF-1, and modest cognitive test changes, but that is too limited for routine anti-aging, fat-loss, vitality, or performance use.
Modern marketing often focuses on body composition, sleep, energy, focus, and weight management. FDA materials and warning letters make product identity, sterility, potency testing, and claims about use in people important concerns.
Claims
Common claims vs evidence
| Claim | Human evidence | Mechanistic evidence | Anecdotal evidence | Verdict |
|---|---|---|---|---|
| Sermorelin helps growth-hormone-deficient children grow. | Historically supported, but narrowly. The best Sermorelin-specific pediatric study reported improved height velocity during daily subcutaneous therapy in growth-hormone-deficient children. Other pediatric work found variable response, and recombinant human GH outperformed GHRH therapy in one comparison. | Sermorelin activates the GHRH receptor and can stimulate pituitary GH release when pituitary reserve is present, which fits the pediatric GHD treatment rationale. | Modern clinic copy may still borrow the pediatric growth-hormone context, but growth velocity in children with GHD says little about what a healthy adult should expect for sleep, body composition, or recovery. | A legitimate historical pediatric claim, not a broad modern adult performance or anti-aging claim. |
| Sermorelin can be used to test GH reserve. | FDA review and older human pharmacology sources describe Sermorelin as a GH stimulation test or pituitary-response tool. Diagnostic challenge sources in the research include IV bolus patterns and comparisons across short-stature or GH-insufficient groups. | A GHRH challenge works because the pituitary response helps distinguish whether the GH axis can respond. That is a diagnostic concept, not a general vitality claim. | Online discussion usually focuses less on diagnostic testing and more on wellness, body composition, or GH-axis optimization. | Historically real for GH reserve testing, but separate from current adult diagnostic-tool choice. |
| Sermorelin is an anti-aging or longevity peptide. | Adult evidence for Sermorelin itself is too small and too old for that claim. The notable healthy older-adult trial studied nightly injections for 6 months and reported GH, IGF-1, and modest cognitive-test changes, but it did not establish longevity, rejuvenation, routine wellness benefit, or durable disease prevention. | GH and IGF-1 biology can affect body composition, sleep architecture, glucose handling, tissue turnover, and subjective recovery. That explains why clinics talk about it, but pathway logic is not the same as measured anti-aging or recovery benefit. | Clinic pages, med-spa programs, and vendor listings commonly use anti-aging, vitality, focus, and sleep language. Those sources show what is being sold, but they do not isolate Sermorelin from diet, training, sleep changes, other hormones, or placebo effects. | The adult evidence is exploratory. The market claims are much broader. |
| Sermorelin is helpful for weight loss, fat loss, or body recomposition. | Sermorelin-specific evidence has not established predictable adult weight loss or body recomposition. Tesamorelin has its own separate visceral-fat evidence in HIV-associated lipodystrophy, but that evidence is for tesamorelin, not Sermorelin. | GH-axis stimulation can connect to lipolysis and IGF-1, which is why the fat-loss pitch exists. The remaining question is whether Sermorelin itself changes fat, lean mass, or waist outcomes in adults. | Clinic and vendor material commonly presents Sermorelin around weight management, metabolism, body composition, and wellness programs. FDA's warning-letter context shows that human weight-loss language around research-use Sermorelin can trigger drug-intent concerns. | Commonly marketed, weakly supported for exact Sermorelin, and easily confused with tesamorelin. |
| Research-use vials or compounded Sermorelin are equivalent to Geref. | Historical Geref evidence describes regulated products, specific indications, and studied settings. A current vial or clinic product still has to document its own identity, sterility, concentration, stability, and adverse-event reporting system. | This is a product-control question rather than a receptor question. A sterile injectable peptide depends on identity, potency, endotoxin, microbial control, storage, reconstitution, and lot-to-lot handling. | Research-use and vendor listings may emphasize COAs, HPLC, purity percentages, and batch documents. FDA inspection and recall materials describe sterility failure, potency-testing issues, and out-of-specification compounded Sermorelin lots. | No; a shared molecule name is not the same as a current product matching a historical regulated drug product. |
Bottom line
Main takeaway
Sermorelin is a real endocrine peptide with a real pharmaceutical past, and both facts get overused. Its proven territory is pediatric deficiency and diagnostic testing; the adult anti-aging uses are mostly marketing built on that past.
Do not let the Geref history blur the comparisons: sermorelin is not tesamorelin, somatropin, macimorelin, or an ipamorelin blend, and each of those carries different evidence. The pediatric record also says nothing about the quality of today's compounded vials.
The useful sources split cleanly by era: FDA and Federal Register records for product status, the Thorner pediatric study for growth response, the Vitiello trial for the only exact-sermorelin adult data, and FDA compounding and recall materials for the modern product problem.
Identity
What it is
Sermorelin is the amidated 1-29 fragment of human GHRH, sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. It sits one step upstream of growth hormone: it activates GHRH receptors on pituitary somatotrophs and depends on the pituitary answering.
Its medical life was genuine. As Geref, it treated growth failure in GH-deficient children and served as a diagnostic probe of pituitary GH reserve, with one year-long multicenter study reporting height velocity rising from 4.1 cm/year to 8.0 at six months on daily bedtime dosing. The same era set a limit worth remembering: in one comparison, recombinant GH improved growth in children where GHRH therapy mostly had not.
Its market life is something else. The anti-aging clinic took the bedtime-injection pattern and the GH story and pointed them at sleep, body composition, energy, and longevity, goals the pediatric trials never measured and the single adult cognition study only touched.
And the molecule in the vial is usually not the molecule from the studies. Geref was a regulated product; today's supply is compounded or research-use material, and FDA records include sermorelin lots that failed sterility and potency testing. The name survived the product.
How people talk about it online
Clinic and med-spa pages present sermorelin as the respectable face of GH optimization: a once-approved drug, a gentle secretagogue, a bedtime injection for sleep, energy, metabolism, and body composition. The respectability comes from Geref; the claims do not.
Vendor and research-use listings lean on purity percentages, COAs, and HPLC language. FDA's own file on sermorelin supply includes a sterility failure, potency-testing problems, and out-of-specification compounded lots, so the paperwork question is not hypothetical here.
Forum discussion borrows the bedtime timing from endocrine practice and applies it to sleep quality, recovery, and recomposition goals. Amounts and cycle lengths vary from post to post, and almost none of it distinguishes compounded vials from the historical drug.
Use context
Routes, doses, and cycle patterns
The study and label history is mostly injectable: diagnostic IV challenge testing, pediatric subcutaneous treatment, and an older adult cognition trial using bedtime subcutaneous injections. Current clinic and vendor discussion also centers on injectable use, but it often shifts the goal from diagnosed deficiency or testing to wellness, body composition, sleep, energy, and recovery.
Human studies and product labels
Historical diagnostic GH stimulation
- Purpose
- Testing pituitary GH reserve
- Context
- FDA review and older human pharmacology
- Route
- Intravenous
- Amount
- 1 mcg/kg in diagnostic challenge sources
- Frequency
- Single administration in challenge testing
- Duration
- Same-day stimulation test
The diagnostic use asks whether the pituitary can release GH after GHRH stimulation. That is different from chronic wellness use.
Pediatric GHD multicenter study
- Purpose
- Linear growth in growth-hormone-deficient children
- Context
- Historical pediatric clinical study
- Route
- Subcutaneous
- Amount
- 30 mcg/kg/day
- Frequency
- Once daily at bedtime
- Duration
- Up to 1 year
The study reported mean height velocity rising from 4.1 cm/year at baseline to 8.0 cm/year at 6 months and 7.2 cm/year at 12 months.
Early pediatric treatment experience
- Purpose
- Growth response in GH-deficient children
- Context
- Historical clinical study
- Route
- Subcutaneous
- Amount
- Exact amount not available in the summarized source
- Frequency
- Twice daily
- Duration
- 6 to 18 months
The cited study summary reports that 8 of 18 children had a worthwhile response and that anti-GHRH antibodies developed in many participants without an obvious adverse growth effect.
Hypothalamic-origin GHD comparison
- Purpose
- Comparing GHRH therapy with recombinant GH
- Context
- Historical pediatric comparator study
- Route
- Subcutaneous
- Amount
- 4 to 6 mcg/kg twice daily for GHRH, then rhGH 2 U/m2 at bedtime
- Frequency
- Twice daily during the GHRH phase
- Duration
- At least 6 months before rhGH comparison
The study is important because GHRH therapy did not improve growth in most participants, while recombinant GH improved growth in all participants in the comparison phase.
Healthy older-adult cognition study
- Purpose
- GH/IGF-1 activation and cognition testing
- Context
- Sermorelin-specific adult clinical study
- Route
- Subcutaneous
- Amount
- 1 mg, about 14 mcg/kg, with escalation to about 2 mg if IGF-1 response was low
- Frequency
- Nightly, about 1 hour before bedtime
- Duration
- 6 months
The study reported GH and IGF-1 increases plus modest cognitive-test improvements. That is relevant adult GH-axis data, not a general longevity, weight-loss, sleep, or routine anti-aging result.
Adjacent [Nle27] GHRH analog aging trial
- Purpose
- Somatotropic-axis activation in older adults
- Context
- Adjacent analog, not exact Sermorelin
- Route
- Subcutaneous
- Amount
- 10 mcg/kg
- Frequency
- Nightly
- Duration
- 16 weeks
This study helps explain nearby GHRH biology, but it used a different analog than exact Sermorelin.
Real-world discussion
Clinic GH-optimization programs
- Purpose
- Sleep, recovery, and body-composition discussion
- Context
- Anti-aging clinics, telehealth, and med-spas
- Route
- Subcutaneous injection
- Amount
- Clinic programs commonly describe 200 to 500 mcg per injection, usually taken before bed to line up with the nighttime growth-hormone pulse.
- Frequency
- Once daily before bed, often five nights per week, in most clinic descriptions
- Duration
- Commonly prescribed in 8 to 12 week or ongoing programs
Sermorelin was once an approved pediatric diagnostic drug and remains a clinic staple, but its evidence for adult anti-aging outcomes is thin. Pre-bed timing is physiology-based convention, not a tested schedule. Reported as context, not a recommendation.
Community and forum use
- Purpose
- Sleep quality and recovery
- Context
- Forums and vendor listings
- Route
- Subcutaneous injection
- Amount
- Community reports commonly describe 200 to 300 mcg before bed
- Frequency
- Nightly or five nights per week
- Duration
- Commonly 8 to 12 weeks in community logs
Gray-market sermorelin quality varies; the clinic-pattern schedule it imitates is itself unproven for the marketed outcomes.
What varies
- Goal: diagnosed pediatric GHD, diagnostic GH testing, adult cognition research, clinic wellness programs, and body-composition talk use different endpoints, populations, and product assumptions.
- Molecule: exact Sermorelin evidence should stay separate from tesamorelin, somatropin, macimorelin, CJC-1295, and ipamorelin-blend claims.
- Route and product: historical Geref evidence describes regulated products; modern compounded or research-use vials need their own identity, sterility, potency, storage, and chain-of-custody checks.
- Amount and duration: pediatric mcg/kg regimens, adult 1 to 2 mg research dosing, and clinic cycles are setting-specific reports.
- Monitoring: GH-axis effects raise questions about IGF-1, glucose handling, edema-like symptoms, injection reactions, and long-term use outside confirmed deficiency.
Human data
Human evidence
The human evidence is real, old, and narrow. The strongest piece is pediatric: a year-long multicenter study in GH-deficient children that improved height velocity on daily bedtime injections, plus a diagnostic literature around pituitary GH reserve. The adult evidence is one exploratory trial in healthy older adults: nightly injections for six months raised GH and IGF-1 and produced modest cognitive-test changes, without establishing any routine anti-aging, sleep, fat-loss, or wellness benefit. Nearby analog studies fill out the biology but are not sermorelin. Nothing in the cited record tests the outcomes the modern market advertises.
Evidence maturity
Sermorelin went from an approved pediatric diagnostic to a compounded clinic staple without ever gaining adult outcome data.
FDA-approved pediatric diagnostic (Geref) in the 1990s.
Brand withdrawn for business reasons; FDA confirmed it was not for safety or effectiveness.
Clinic anti-aging programs without controlled adult outcome trials.
WADA-prohibited as a GH-releasing factor.
| Study / evidence area | Population | Design | Product context | Main outcome | Limitations | Weight |
|---|---|---|---|---|---|---|
| Historical Geref and FDA/Federal Register context | Children with growth failure associated with growth hormone deficiency; diagnostic GH reserve evaluation | FDA orphan-designation and Federal Register discontinued-product context | Historical Geref regulated products | FDA records support historical pediatric and diagnostic product contexts and a later determination that discontinuation was not for safety or effectiveness reasons. | Discontinued-product status says nothing about the quality of current compounded, clinic-supplied, or research-use Sermorelin products. | Moderate |
| Thorner et al. pediatric GHD multicenter study | Prepubertal children with growth hormone deficiency | Historical multicenter open-label clinical study | Geref / exact GHRH (1-29) context | Daily bedtime subcutaneous GHRH (1-29) at 30 mcg/kg/day increased mean height velocity from 4.1 cm/year to 8.0 cm/year at 6 months and 7.2 cm/year at 12 months in the cited study summary. | Legacy pediatric GHD treatment evidence does not settle adult wellness, anti-aging, body-composition, or performance claims. | Moderate |
| Pediatric review of diagnosis and treatment | Children with idiopathic growth hormone deficiency | Review | Historical pediatric diagnosis and treatment context | The review summarizes Sermorelin's diagnostic and pediatric treatment context, helping distinguish pituitary-response testing from broad consumer claims. | A pediatric review does not settle modern adult off-label safety, long-term use, or product quality. | Moderate |
| Older GHRH analog response study | Normal subjects plus children and young adults with growth hormone deficiency | Human pharmacology and response study | Exact GHRH (1-29)-NH2 and analog response context | Human response data support the idea that GHRH fragments can provoke GH release when the pituitary axis can respond. | Response testing and mechanism do not settle body-composition, sleep, recovery, or longevity outcomes by themselves. | Limited |
| Healthy older-adult cognition study | Healthy older adults | Sermorelin-specific adult clinical study | Sermorelin acetate / Geref research context | The cited study summary reports about 100% GH increase, about 33.8% IGF-1 increase, and modest cognitive-test improvements after nightly subcutaneous dosing for 6 months. | This is an exploratory adult finding, not a routine anti-aging, weight-loss, sleep, or disease-treatment result. | Limited |
| Adjacent [Nle27] GHRH aging trial | Age-advanced adults | Adjacent analog clinical study | Different GHRH analog, not exact Sermorelin | The cited study summary reports increased nocturnal GH and IGF-1, a lean-body-mass signal in men, and no sleep-quality improvement. | Adjacent analog data can explain biology, but they are not direct Sermorelin efficacy evidence. | Weak |
Cautions
Safety and unknowns
- GH-axis monitoring is part of the clinical conversation around repeated use: IGF-1 and glucose tracking, and for men, prostate monitoring, since physician reports describe PSA movement on GH secretagogues in susceptible individuals.
- Older pediatric and diagnostic sources report injection-site reactions and transient events such as flushing, headache, pallor, nausea, vomiting, metallic taste, chest tightness, dizziness, somnolence, hyperactivity, dysphagia, urticaria, and anti-GHRH antibodies in some patients.
- The older adult cognition study described side effects as uncommon, with occasional injection-site erythema or swelling in roughly 2 percent of subjects in the research summary.
- The modern adult questions are less settled: long-term off-label exposure, chronic GH-axis stimulation, IGF-1 monitoring, glucose handling, edema-like symptoms, cancer-surveillance concerns in older adults, and use in people without confirmed deficiency.
- Current compounded and research-use products add separate risks around identity, concentration, sterility, endotoxin, potency stability, storage, reconstitution, shipping, and adverse-event reporting.
Product quality
A vial label is only a starting point
Historical Geref evidence describes a regulated product history. A modern compounded vial, clinic vial, or research-use product needs its own quality documentation.
FDA materials include Sermorelin-related sterility failure, potency-testing, and manufacturing-control concerns.
COA, purity, and HPLC language can help with a narrow identity question, but they leave open sterility, endotoxin, potency over time, reconstitution, storage, chain of custody, or labeling for use in people.
Identity
Sermorelin is easily confused with tesamorelin, modified GRF, CJC-1295, ipamorelin blends, and generic GH-secretagogue marketing.
Sterility and endotoxin
A sterile injectable needs microbial and endotoxin controls; a purity percentage is only part of identity testing.
Potency and concentration
Dose math depends on actual vial content, concentration, fill accuracy, reconstitution volume, and stability.
Storage and handling
Lyophilized peptides and reconstituted products can degrade or lose potency if storage, shipping, or handling is poor.
Oversight for use in people
Research-use disclaimers, clinic marketing, and compounded supply do not provide the same label and release program as an FDA-reviewed product.
Mechanism
How it is proposed to work
Sermorelin works by mimicking the active 1-29 fragment of GHRH. It binds the GHRH receptor on pituitary somatotroph cells and can increase pulsatile GH release, which then affects downstream IGF-1 signaling.
The GHRH receptor is a class B GPCR that signals largely through Gs, adenylyl cyclase, cAMP, and protein kinase A. That is why Sermorelin can raise GH and IGF-1 biomarkers when the pituitary axis is responsive.
The molecule is short-acting, with the cited study summary noting a minute-scale plasma half-life for human GHRH (1-29)-NH2. Stabilized analogs such as tesamorelin were developed because exact GHRH fragments have different pharmacokinetic behavior.
Mechanism explains why the idea is plausible. The pediatric studies show variable growth response, and adult wellness claims still need outcome-specific human evidence.
Sermorelin is GHRH(1-29) amide: the first 29 amino acids of GHRH, which retain full receptor activity. It is the shortest GHRH fragment with complete biological effect, which is why it became the canonical compounded GHRH option.
FAQ
Common questions
Is sermorelin an approved anti-aging or body-composition peptide?
The best-supported context is historical Geref use in pediatric growth-hormone deficiency and diagnostic evaluation. Adult anti-aging, body-composition, and performance claims need their own support.
What does the FDA discontinued-product notice mean?
It means FDA determined the historical Geref products were not withdrawn for safety or effectiveness reasons. It does not mean every modern sermorelin product has the same evidence, identity, labeling, or quality controls.
Why is sermorelin grouped with growth hormone secretagogues?
Sermorelin is a GHRH fragment analog that works through the growth hormone-releasing hormone pathway. That mechanism is relevant for child-GHD and diagnostic-response context, but it is not enough to support broad wellness claims.
Details
Technical details
Sources
References
- 1.
Accessed 2026-06-09.
Federal Register notice identifying historical Geref treatment and diagnostic uses, discontinued marketing status, and FDA's not-withdrawn-for-safety-or-effectiveness determination.
- 2.
FDA. Orphan Drug Designations and Approvals: Geref (sermorelin acetate) 1988.
Accessed 2026-06-09.
FDA orphan-designation record for Geref in idiopathic or organic growth hormone deficiency in children with growth failure, including the 1997 marketing-approval date.
- 3.
doi:10.1210/jcem.81.3.8772599 PMID:8772599 Accessed 2026-06-09.
Geref International Study Group pediatric growth-hormone-deficiency evidence source; used for historical child-GHD evidence context, not for adult wellness or body-composition claims.
- 4.
PubMed. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency 1999.
doi:10.2165/00063030-199912020-00007 PMID:18031173 Accessed 2026-06-09.
Review source covering diagnosis and pediatric idiopathic growth-hormone-deficiency treatment context for sermorelin.
- 5.
doi:10.1111/j.1365-2265.1984.tb03477.x PMID:6236914 Accessed 2026-06-09.
Human pharmacology and diagnostic-context source for GHRH(1-29)NH2 responses in normal subjects and growth-hormone-deficient children and young adults.
- 6.
Other. PubChem Compound Summary for Sermorelin 2026.
Accessed 2026-06-09.
PubChem source for CID 16132413, molecular formula C149H246N44O42S, and molecular weight 3357.9 g/mol.
- 7.
FDA macimorelin review. FDA macimorelin medical review summarizing historical sermorelin identity, uses, dosing context, and adverse events.
Identity and historical labeled contexts.
- 8.
Ross 1987 pediatric GHRH. Ross et al. 1987 early pediatric GHRH treatment study.
Variable responder pattern and antibody notes.
- 9.
Butenandt 1989 comparison. Butenandt and Staudt 1989 comparison of GHRH and recombinant growth hormone.
Prevents equivalence claims with GH replacement.
- 10.
Tuilpakov 1995 reserve. Tuilpakov et al. 1995 acute GH-release study in children with short stature or GH insufficiency.
Diagnostic reserve-dependence context.
- 11.
Vitiello 2006 cognition. Vitiello et al. 2006 healthy older adults cognition study using sermorelin acetate.
Best exact-sermorelin adult study located.
- 12.
Khorram 1997 GHRH analog. Khorram et al. 1997 older-adult GHRH analog trial.
Adjacent analog context, not exact-sermorelin proof.
- 13.
FDA compounding Q&A. FDA Compounding Q&A.
Compounded drugs are not FDA-approved.
- 14.
FDA Xcel warning. FDA warning letter to Xcel Research LLC.
Research-use marketing crossed into human-use claims.
- 15.
FDA Town and Country warning. FDA warning letter to Town and Country Compounding.
Sterility failure in compounded sermorelin and GHRP-6 lot.
- 16.
FDA Hybrid Pharma 483. FDA Hybrid Pharma Form 483 response.
Bulk-substance and manufacturing-control issues involving sermorelin acetate injection.
- 17.
FDA Absolute Pharmacy 483. FDA Absolute Pharmacy Form 483 with sermorelin-related potency testing failure.
Potency-testing and supplier-quality concerns.
- 18.
FDA Egrifta SV label. FDA EGRIFTA SV label for tesamorelin.
Non-equivalence with tesamorelin and claim separation.
- 19.
FDA Macrilen label. FDA Macrilen label.
Current adult diagnostic comparison.
- 20.
Clinic marketing pages. Reviewed clinic and pharmacy marketing pages for sermorelin.
Claim-environment mapping, not efficacy proof.
- 21.
RUO sermorelin COA page. Research-use sermorelin page with COA and purity language.
COA discussion and market structure.
- 22.
Additional RUO listings. Additional research-use sermorelin pages with purity, HPLC, and batch-document language.
Product-quality narrative context.