Peptide education

Tesamorelin

Egrifta · Egrifta SV · GHRF analog · GHRH analog · TH9507

Tesamorelin is a 44-amino-acid analog of growth hormone-releasing hormone, sold as Egrifta, and it is the rare peptide in this market with an actual FDA approval behind it. Daily subcutaneous injections reduced visceral abdominal fat in adults with HIV-associated lipodystrophy in randomized trials, which is more controlled outcome data than most GH peptides ever get. Two limits define everything else said about it: the studied population is specific, and the fat comes back when treatment stops. The waist, cutting, liver-fat, sleep, and anti-aging talk that fills clinic pages and forums borrows that trial record and applies it to people and products the trials never covered.

Tesamorelin actually did what most GH peptides only promise: it shrank visceral belly fat in controlled trials, in adults with HIV-associated lipodystrophy. The catch is that the approval covers that population, the effect reverses when you stop, and nothing in the trial record tests the cutting, anti-aging, or sleep uses the market sells.

Main interestVisceral fat and waist change
Common routeSubcutaneous injection
Known schedulesDaily use over months
Product issueEgrifta vs market vials

Overview

Quick answer

Tesamorelin shows up in several separate settings: FDA-labeled Egrifta products, randomized HIV trials, clinic or med-spa services, Reddit or forum cycles, and research-use vendor vials. The route is usually subcutaneous injection, but an approved Egrifta prescription, a monitored trial dose, a clinic program, and a research-use vial are not interchangeable.

What is tesamorelin?

Tesamorelin is a synthetic analog of growth hormone-releasing hormone: it tells the pituitary to release more of the body's own GH, which raises IGF-1 downstream. It is not growth hormone itself, and it is not a GLP-1-style appetite drug.

What is it actually used for?

The approved use is narrow and specific: reducing excess abdominal fat in adults with HIV-associated lipodystrophy. Everything else you will see, belly-fat programs, cutting cycles, fatty-liver talk, anti-aging packages, is off-label use that cites the HIV trials while studying none of those goals.

What dose details appear in labels and studies?

The label numbers are product-specific: Egrifta SV lists 1.4 mg once daily, Egrifta WR lists 1.28 mg once daily from an 11.6 mg vial, and the older HIV trials used 2 mg daily for months. Those figures describe regulated products in studied settings; a clinic vial or research-use listing does not inherit them.

How do off-label users talk about it?

Forum reports read like practical logs: daily injections, belly-fat change, cutting, sleep, and whether the cost felt justified. They document what people try, but doses, products, and monitoring vary so much that no off-label standard emerges from them.

What changes the interpretation most?

The population and the product. A visceral-fat result in adults with HIV on antiretroviral treatment does not transfer to cosmetic weight loss, and trial-grade Egrifta does not transfer to a gray-market vial whose sterility, potency, and storage are unverified.

Reported practice

Commonly reported protocol

Tesamorelin community-reported use
Route
Subcutaneous injection
Typical amount
Clinic programs commonly mirror the older 2 mg once daily trial amount. Community recomposition reports describe 1 to 2 mg daily, sometimes five days on and two days off.
Frequency
Once daily, usually in the evening or fasted, in most descriptions
Duration
Usually 8 to 12 week or longer runs, sometimes open-ended under clinic supervision

Clinic and community body-composition programs. Community-reported patterns, not verified by controlled human trials and not a use recommendation. Full use-pattern detail

Evidence

Evidence snapshot

FDA labelHIV-associated abdominal fat

Egrifta labels describe tesamorelin for reducing excess abdominal fat in adults with HIV-associated lipodystrophy, with product-specific daily subcutaneous dosing and preparation.

Randomized trial2 mg daily lowered visceral fat

Pooled phase 3 HIV abdominal-fat trials used 2 mg subcutaneously once daily and reported about 15.4% visceral-adipose-tissue reduction versus placebo over 26 weeks, with benefit maintained during continued treatment and fat returning toward baseline after stopping.

Liver-fat study2 mg daily for 6 months

A JAMA randomized trial in adults with HIV and abdominal fat accumulation studied 2 mg subcutaneously once daily for six months and reported visceral-fat and liver-fat outcomes.

Claims

Common claims vs evidence

ClaimHuman evidenceMechanistic evidenceAnecdotal evidenceVerdict
Tesamorelin reduces visceral belly fat.This is the core human claim. The FDA label and pooled phase 3 randomized HIV trials support reduction of excess abdominal fat in adults with HIV-associated lipodystrophy. The phase 3 program used daily subcutaneous dosing over months and measured visceral adipose tissue rather than quick appetite-driven weight loss. Public trial summaries report about 15.4% VAT reduction at 26 weeks in pooled phase 3 data, and a separate randomized trial reported about 10.9% VAT reduction over six months with reversal after discontinuation. Tesamorelin stimulates GHRH receptors, increases endogenous GH pulses, and raises IGF-1. That biology fits the visceral-fat and ectopic-fat research better than a simple "fat burner" label. Clinic pages and Reddit/forum discussions often translate "visceral fat" into ordinary belly-fat, waist, or cutting language. That is the main off-label leap: same molecule, different patients, product controls, and dosing context. Best supported for HIV-associated visceral abdominal fat. General belly-fat or cosmetic cutting talk usually extrapolates from that data.
Tesamorelin causes general weight loss.The label and trials are more about visceral-fat distribution than total scale weight. In the labeled setting, the main finding is abdominal fat distribution rather than GLP-1-style appetite suppression. GH-axis stimulation can affect lipolysis and body composition, but that is not the same as appetite suppression or broad obesity treatment. One clinic protocol sells tesamorelin for visceral-fat reduction and body recomposition. A first-person Reddit cycle report described perceived fat loss and strength while cutting, but had not yet confirmed the body-fat change by DEXA. Better described as a visceral-fat and body-composition claim than a general weight-loss claim.
Tesamorelin may improve liver fat.A JAMA randomized trial in adults with HIV and abdominal fat accumulation used 2 mg subcutaneously once daily for six months and reported liver-fat and visceral-fat outcomes. Visceral fat, hepatic fat, GH signaling, and substrate handling are connected enough that liver-fat research makes biological sense. Online discussion often turns that liver-fat finding into broad "metabolic health" language. That is a larger claim than the cited JAMA HIV trial itself can carry. The liver-fat finding comes from HIV-related studies using a specific route, dose, duration, and population.
Tesamorelin is an anti-aging, recovery, or sleep peptide.The available tesamorelin sources do not include a human trial showing sleep, recovery, longevity, or healthy-aging outcomes. The interest comes from GH/IGF-1 signaling plus clinic and forum experience claims. GH and IGF-1 biology can affect tissue repair, fluid balance, glucose handling, body composition, and subjective recovery. That explains why the claims appear, and why monitoring and safety questions show up. The direct market examples found here focus on body composition, GH-axis stacking, and timing around sleep rather than measured recovery, longevity, or healthy-aging outcomes. One clinic handout uses five weekly bedtime injections in three-month cycles; a seller guide recommends daily evening injections for 12 to 26 weeks. These are off-label extrapolations. The cited market examples show timing and body-composition programs, not direct human evidence for sleep, recovery, or anti-aging.
Research-use or gray-market tesamorelin is equivalent to Egrifta.The FDA label and approval evidence describe regulated Egrifta products, not every compounded supply, clinic vial, or research-use vendor listing that uses the tesamorelin name. Even if the intended receptor target is the same, the product still has to be the right material at the right potency, with sterility, endotoxin control, diluent, storage, handling, and chain of custody documented. Vendor listings and COAs may emphasize purity or identity. Clinic pages may present a wellness program. Those details are not Egrifta-level formulation, manufacturing control, storage, sterility, or adverse-event tracking. The name tesamorelin does not show whether a vial is Egrifta-like, sterile, correctly concentrated, stored correctly, or monitored like the products used in trials.

Bottom line

Main takeaway

If you just heard the name

Tesamorelin is a prescription drug with real controlled-trial evidence for one job: reducing excess visceral belly fat in adults with HIV-associated lipodystrophy. That makes it the best-evidenced peptide in this space and, at the same time, a poor template for general fat-loss claims.

If you are comparing fat-loss or GH peptides

Ask two questions before any comparison: which population was studied, and which product was used. The HIV trial record supports a monitored, months-long visceral-fat discussion; clinic programs, Reddit cycles, and research-use vials answer neither question.

Best starting sources

Start with the FDA labels and approval letter, then the pooled phase 3 visceral-fat data and the JAMA liver-fat trial. Those sources define what was actually proven, for whom, and on which product.

Identity

What it is

Tesamorelin is a 44-amino-acid analog of growth hormone-releasing hormone. It works upstream of growth hormone: it stimulates the pituitary to release the body's own GH rather than replacing it with recombinant GH, and IGF-1 rises downstream.

What separates it from nearly every other peptide sold online is the trial record. Randomized phase 3 studies in adults with HIV-associated lipodystrophy used 2 mg daily for about 26 weeks and measured visceral adipose tissue directly, reporting roughly 15.4% reduction versus placebo, with a separate trial reporting about 10.9% over six months. The same record draws the boundary: visceral fat drifted back toward baseline after treatment stopped.

That is the whole honest story, and it is narrower than the market's version. Clinics translate visceral fat in HIV lipodystrophy into waist-size and cutting language, forums trade daily-injection routines, and the JAMA liver-fat finding gets inflated into general metabolic-health promises. Each step away from the studied population is a step away from the evidence.

The product question is the last boundary. Egrifta SV and Egrifta WR are regulated formulations with exact daily amounts; a vendor vial that shares the tesamorelin name has to prove its own identity, sterility, concentration, and storage before any trial number applies to it.

How people talk about it online

Clinic and med-spa pages sell tesamorelin as a body-composition or anti-aging service, with waist, visceral-fat, and GH/IGF-1 language borrowed straight from the HIV label. The word visceral does quiet work in that copy: in the trials it meant a measured fat compartment in a defined patient group, and in the marketing it means your belly.

Reddit and forum threads are more concrete: daily injection routines, multi-week cuts, sleep and recovery impressions, lab checks, and debates about whether the cost is justified. The schedule people copy is the trial pattern of daily use over months, but product identity and dosing discipline are inconsistent enough that these reports show demand, not outcomes.

A widely reported open secret in celebrity and influencer transformations is a three-part stack: testosterone replacement, a GLP-1, and a GH-axis secretagogue such as tesamorelin or a CJC-1295 variant. Attributing any single transformation to one peptide is not possible under that pattern, and it is worth keeping in mind whenever a dramatic before-and-after is attached to one product.

Vendor listings turn all of this into a quality question. A research-use vial can carry the tesamorelin name while differing from Egrifta in formulation, sterility, endotoxin control, storage, and oversight, which is exactly where the trial-derived expectations stop applying.

Use context

Routes, doses, and cycle patterns

Most documented schedules use daily subcutaneous dosing. FDA labels provide the most concrete current product schedules: Egrifta SV 1.4 mg / 0.35 mL daily and Egrifta WR 1.28 mg / 0.16 mL daily from an 11.6 mg vial prepared with bacteriostatic water for seven daily doses. Older HIV visceral-fat studies and the JAMA liver-fat study used 2 mg subcutaneously once daily over months. Clinic, forum, Reddit, online protocol, and gray-market discussions usually copy those daily patterns while changing the goal and product setting.

Human studies and product labels

Egrifta SV FDA label

Purpose
Excess abdominal fat in adults with HIV-associated lipodystrophy
Context
FDA label
Route
Subcutaneous abdominal injection
Amount
1.4 mg / 0.35 mL
Frequency
Once daily
Duration
Labeled treatment, not a short-cycle schedule

Egrifta SV uses a specific daily amount, injection volume, and preparation process. Those details matter when people compare the approved product with clinic supply or research-use vials.

Egrifta WR FDA label

Purpose
Excess abdominal fat in adults with HIV-associated lipodystrophy
Context
FDA label
Route
Subcutaneous abdominal injection
Amount
1.28 mg / 0.16 mL
Frequency
Once daily
Duration
Seven daily doses after preparing one 11.6 mg vial

The WR label uses a vial-based formulation, while SV uses a different presentation. Amount, volume, handling, and product-comparison details should not be swapped between WR, SV, clinic supply, or research-use vials.

Older pivotal HIV abdominal-fat studies

Purpose
Visceral abdominal fat reduction
Context
Pooled randomized phase 3 trial evidence
Route
Subcutaneous
Amount
2 mg
Frequency
Once daily
Duration
About 26 weeks, with extension follow-up in the development program

This older 2 mg daily pattern is why many online discussions remember that dose. In pooled phase 3 data, it was tied to about 15.4% VAT reduction at 26 weeks, plus triglyceride and body-image measures in an HIV abdominal-fat population. Other randomized data reported about 10.9% VAT reduction over six months and reversal after stopping.

JAMA HIV visceral-fat and liver-fat study

Purpose
Visceral adipose tissue and liver-fat outcomes
Context
Randomized JAMA trial
Route
Subcutaneous
Amount
2 mg
Frequency
Once daily
Duration
6 months

This is why liver fat comes up in tesamorelin discussions. The trial studied adults with HIV and abdominal fat accumulation, not a general consumer fatty-liver program.

Real-world discussion

Clinic and community body-composition programs

Purpose
Visceral fat and body-recomposition discussion
Context
Clinics, telehealth programs, and community reports
Route
Subcutaneous injection
Amount
Clinic programs commonly mirror the older 2 mg once daily trial amount. Community recomposition reports describe 1 to 2 mg daily, sometimes five days on and two days off.
Frequency
Once daily, usually in the evening or fasted, in most descriptions
Duration
Usually 8 to 12 week or longer runs, sometimes open-ended under clinic supervision

Tesamorelin is an approved drug (HIV-associated lipodystrophy), so clinic use is off-label but legitimate prescribing; gray-market vials are the unverified version. The labeled visceral-fat evidence does not extend to cosmetic weight loss. That is the reported picture, not advice.

What varies

  • Goal: visceral fat, scale weight, liver fat, recovery, sleep, and anti-aging are different reasons people look at tesamorelin.
  • FDA labels give approved-product dosing; randomized trials give measured outcomes; clinic pages show services; Reddit and forum reports show user goals and routines; vendor listings show what is being sold.
  • Product: Egrifta SV, Egrifta WR, older trial drug, clinic supply, and research-use vials can differ in concentration, diluent, storage, and controls.
  • Time: the human visceral-fat and liver-fat studies measured months of daily use, not a few days.
  • Monitoring: IGF-1, glucose, edema or fluid retention, injection-site reactions, hypersensitivity, malignancy history, and pregnancy warnings matter because this is a GH-axis drug.

Human data

Human evidence

Tesamorelin has the deepest human evidence of any peptide in this market, and it is still a narrow record. Pooled phase 3 data in adults with HIV-associated lipodystrophy reported about 15.4% visceral-fat reduction at 26 weeks on 2 mg daily, with a separate randomized trial reporting about 10.9% over six months and fat returning after discontinuation. The liver-fat signal comes from a JAMA trial in the same kind of HIV population, not from a general fatty-liver program. No human trial in the cited record tests sleep, recovery, longevity, cosmetic weight loss, or anti-aging. The evidence says one thing well, about one population, on one regulated product.

Evidence maturity

Tesamorelin has the complete evidence arc for one narrow indication; clinic use extends it beyond the proven population.

Phase 3 RCTs

Randomized visceral-fat reduction trials in HIV lipodystrophy.

FDA approval 2010

Egrifta approved for HIV-associated lipodystrophy.

Label evolution

Egrifta SV formulation and JAMA liver-fat data added depth.

Off-label clinic use

Body-recomposition programs extrapolate beyond the studied population.

Study / evidence areaPopulationDesignProduct contextMain outcomeLimitationsWeight
FDA-approved Egrifta productsAdults with HIV-associated lipodystrophyFDA approval and prescribing-information sourceApproved Egrifta productsThe label supports use for reducing excess abdominal fat in the named adult HIV lipodystrophy population and provides current daily subcutaneous product schedules. The label is about Egrifta in HIV-associated lipodystrophy. Clinic vials, research-use vials, cutting plans, and anti-aging programs require their own product and monitoring details. Strong for labeled use
Pooled phase 3 HIV abdominal-fat trialsAntiretroviral-treated adults with HIV and excess abdominal fatPooled randomized, double-blind, placebo-controlled phase 3 evidenceControlled clinical trial settingDaily 2 mg subcutaneous tesamorelin over about 26 weeks reduced visceral adipose tissue, with public summaries reporting about 15.4% VAT reduction versus placebo in pooled phase 3 data and maintenance while treatment continued. This was an HIV abdominal-fat population with trial monitoring, not a general consumer weight-loss or anti-aging population. Benefit was not permanent after discontinuation in extension/discontinuation data. Strong human evidence
JAMA HIV visceral-fat and liver-fat trialAdults with HIV and abdominal fat accumulationRandomized clinical trialControlled research settingDaily 2 mg subcutaneous tesamorelin for six months reported visceral-fat and liver-fat outcomes, which is why liver-fat claims depend on the HIV study context. The HIV-related study is too narrow to cover every fatty-liver, longevity, or broad metabolic claim in the broader market. Moderate human evidence
Clinic, Reddit, forum, online protocol, and vendor discussionPeople discussing off-label body-composition, GH-axis, recovery, sleep, or anti-aging useAnecdotal, marketing, and gray-market discussionOff-label clinic, forum, and vendor-market contextClinic pages, forums, protocol posts, and vendors document demand for waist change, cutting, recovery, sleep, anti-aging, and GH/IGF-1 effects, usually with daily-use language copied from labels or human studies. They show real-world interest, but dose reporting, product identity, monitoring, and outcomes are inconsistent. Anecdotal and marketing context

Use context

Reported use context

Tesamorelin appears in several separate settings. FDA labels give product-specific daily schedules. Randomized HIV trials used daily 2 mg dosing over months. Clinics and online protocol pages sell it as a body-composition or GH-axis service. Forum and Reddit posts show what users watch for, while vendor and gray-market listings raise product-quality issues for non-Egrifta vials.

Study and label context

01
FDA label, Egrifta SV and Egrifta WRSubcutaneous label route

SV and WR list different daily amounts, volumes, and handling details. Do not swap label details between products.

02
Randomized HIV abdominal-fat trialSubcutaneous

Pooled phase 3 HIV data used 2 mg once daily for about 26 weeks and reported about 15.4% VAT reduction versus placebo. VAT tended to return after stopping.

03
Randomized JAMA HIV liver-fat trialSubcutaneous

The JAMA trial used 2 mg once daily for six months in adults with HIV and abdominal fat accumulation, tracking visceral and liver fat.

Real-world discussion

01
Clinic page / med-spa marketingInjectable program marketing

Two clinic examples publish different schedules: 1 to 2 mg daily over 8 to 26 weeks, and 1.25 mg five evenings per week for three months on and one month off.

02
Reddit thread / forum reportInjectable use reports

One stacked-use report describes a 14-week cut, daily morning injections, a move from 1 mg to 1.5 mg with a brief 2 mg period, perceived fat loss and strength, and tingling that prompted a dose reduction.

03
Online wellness planWellness-plan marketing

A clinic protocol markets 1 to 2 mg daily tesamorelin stacks over 8 to 26 weeks for body composition and GH-axis goals.

04
Vendor listing / gray-market listingInjectable-vial context

One research-use seller offers 5 mg, 10 mg, and 20 mg vial choices alongside a daily injection and reconstitution guide. Its purity language and disclaimer do not establish Egrifta equivalence, sterility, or endotoxin control.

Cautions

Safety and unknowns

  • The label highlights long-term cardiovascular uncertainty, so visible visceral-fat change and long-term outcome benefit do not move in lockstep.
  • Tesamorelin raises GH and IGF-1 signaling. IGF-1 elevation, glucose intolerance or diabetes, retinopathy monitoring in people with diabetes, fluid retention, edema-type symptoms, and carpal-tunnel-like complaints are practical monitoring themes. In label-linked trial data, 47% of treated patients had IGF-1 above 2 SDS at 26 weeks, 36% were above 3 SDS, and the reported diabetes risk estimate versus placebo was 3.3.
  • Hypersensitivity, injection-site reactions, active malignancy history, pregnancy warnings, hypothalamic-pituitary-axis disruption, and acute critical illness warnings are part of the product label.
  • Clinic, research-use, and gray-market products add identity, potency, sterility, endotoxin, diluent, storage, reconstitution, and chain-of-custody questions that the approved-product trials do not answer.

Product quality

A vial label is only a starting point

Egrifta label and trial evidence describe regulated products and study material. Market vials using the tesamorelin name need their own quality and handling evidence.

For injectable peptides, product quality is more than purity. Identity, potency, sterility, endotoxin control, container closure, diluent, storage, and repeated vial access all matter.

Identity

The product has to contain the intended tesamorelin material, not simply use the name in a listing.

Formulation

SV, WR, older trial drug, clinic supply, and research-use vials can differ in amount, concentration, diluent, volume, and storage rules.

Sterility and endotoxin

An injectable product can have a convincing purity claim while still leaving sterility or endotoxin questions unanswered.

Handling

Reconstitution, storage temperature, repeated vial entry, and shipping conditions can change the practical risk of the product people actually use.

Mechanism

How it is proposed to work

Tesamorelin stimulates GHRH receptors in the pituitary, increasing the body's own growth hormone pulses and raising downstream IGF-1 signaling.

01

GH signaling is tied to lipolysis and fat distribution, which helps explain the visceral-fat and body-composition interest.

02

The liver-fat hypothesis fits the same biology because visceral fat, hepatic fat, substrate handling, and GH signaling are linked.

03

The safety tradeoffs come from the same pathway: glucose handling, fluid retention, tissue-growth signaling, IGF-1 exposure, and injection reactions are not side issues for a GH-axis drug.

04

Tesamorelin is full-length GHRH(1-44) with a trans-3-hexenoyl N-terminal cap that resists DPP-4 cleavage. It stimulates physiologic pulsatile GH release rather than replacing GH itself.

05

Its visceral-fat effect is attributed to restored GH/IGF-1 signaling driving lipolysis preferentially in visceral adipose tissue: the mechanism tested in the HIV lipodystrophy trials, not a general weight-loss mechanism.

FAQ

Common questions

Is tesamorelin a general weight-loss peptide?

No. The approved use is reduction of excess abdominal fat in adults with HIV-associated lipodystrophy. The label explicitly separates that from weight-loss management.

Does the HIV lipodystrophy evidence apply to fitness or anti-aging use?

Tesamorelin has controlled human visceral-fat data, but the strongest evidence is still tied to HIV-associated lipodystrophy and regulated Egrifta products. Fitness, cutting, anti-aging, and peptide-stack use are off-label extrapolations unless the source is studying that exact setting.

Why is the rule-list risk high?

Growth hormone-releasing factors, including tesamorelin, are restricted in some rule-governed settings. Eligibility depends on current official rules rather than general medical-use language.

Details

Technical details

Tesamorelin technical details
Generic name
Tesamorelin
Brand names
Egrifta, Egrifta SV, Egrifta WR
Class
Growth hormone-releasing hormone analog
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Length
44 amino acids
Approved use
Excess abdominal fat in HIV-associated lipodystrophy
Labeled route
Subcutaneous abdominal injection
Egrifta SV amount
1.4 mg / 0.35 mL once daily
Egrifta WR amount
1.28 mg / 0.16 mL once daily from an 11.6 mg vial
Older study amount
2 mg subcutaneously once daily in HIV visceral-fat and liver-fat studies
Half-life
Roughly 26 to 38 minutes after subcutaneous injection. Daily dosing reflects the short half-life and the intent to pulse GH release.

Sources

References

  1. 1.

    DailyMed. EGRIFTA SV- tesamorelin kit prescribing information 2025.

    Accessed 2026-06-09.

    Current structured product label source for Egrifta SV indication, limitations of use, warnings, pharmacology, and product identity.

  2. 2.

    DailyMed. EGRIFTA WR- tesamorelin kit prescribing information 2025.

    Accessed 2026-06-10.

    Current structured product label source for Egrifta WR dosing, reconstitution, weekly vial format, storage, indication, and product identity.

  3. 3.

    FDA. Egrifta (tesamorelin for injection) NDA approval letter 2010.

    Accessed 2026-06-09.

    FDA approval letter for Egrifta for reduction of excess abdominal fat in HIV-infected patients with lipodystrophy.

  4. 4.

    PubMed. Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat 2010.

    PMID:20554713 Accessed 2026-06-09.

    Pooled phase 3 randomized placebo-controlled trial evidence in antiretroviral-treated people with HIV and excess abdominal fat.

  5. 5.

    PubMed. Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial 2014.

    PMID:25038357 Accessed 2026-06-09.

    Randomized clinical trial adding a liver-fat and visceral-fat research lane in HIV-infected participants with abdominal fat accumulation.

  6. 6.

    Hatter Labs tesamorelin protocol. Clinic protocol page marketing monitored tesamorelin and peptide stacks for body composition.

    Direct clinic evidence for off-label body-composition goals, daily amounts, stack examples, and 8-to-26-week courses.

  7. 7.

    Extension Health tesamorelin handout. Clinic patient-information PDF with a five-injection weekly schedule and three-month cycle.

    Direct clinic evidence that off-label schedules can differ from daily Egrifta labeling.

  8. 8.

    Reddit tesamorelin cycle report. First-person Reddit report describing a stacked 14-week tesamorelin cycle, lab checks, perceived effects, and tingling.

    Anecdotal amount, timing, cycle, benefit, and adverse-effect context; not efficacy evidence.

  9. 9.

    JA Performance Peptides tesamorelin guide. Research-use seller page offering several vial sizes with a daily injection and cycle guide.

    Direct vendor evidence for vial formats, protocol claims, research-use disclaimer, and product-equivalence cautions.